PDB entry 1mwa

View 1mwa on RCSB PDB site
Description: 2c/h-2kbm3/dev8 allogeneic complex
Class: immune system
Keywords: Ig domain, antigen recognition, complementarity determining region, IMMUNE SYSTEM
Deposited on 2002-09-27, released 2002-11-27
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.285
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2c t cell receptor alpha chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB 1012285A (0-201)
      • see remark 999 (121)
      • see remark 999 (157)
    Domains in SCOPe 2.02: d1mwaa1, d1mwaa2
  • Chain 'B':
    Compound: 2c t cell receptor beta chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAB41230 (0-236)
      • see remark 999 (95)
      • see remark 999 (97-99)
      • see remark 999 (102)
      • see remark 999 (107)
    Domains in SCOPe 2.02: d1mwab1, d1mwab2
  • Chain 'C':
    Compound: 2c t cell receptor alpha chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB 1012285A (0-201)
      • see remark 999 (121)
      • see remark 999 (157)
    Domains in SCOPe 2.02: d1mwac1, d1mwac2
  • Chain 'D':
    Compound: 2c t cell receptor beta chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAB41230 (0-236)
      • see remark 999 (95)
      • see remark 999 (97-99)
      • see remark 999 (102)
      • see remark 999 (107)
    Domains in SCOPe 2.02: d1mwad1, d1mwad2
  • Chain 'H':
    Compound: h-2kbm3 MHC class I molecule heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01901 (0-End)
      • conflict (76)
      • conflict (88)
    Domains in SCOPe 2.02: d1mwah1, d1mwah2
  • Chain 'I':
    Compound: h-2kbm3 MHC class I molecule heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01901 (0-End)
      • conflict (76)
      • conflict (88)
    Domains in SCOPe 2.02: d1mwai1, d1mwai2
  • Chain 'L':
    Compound: microglobulin MHC light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1mwal_
  • Chain 'M':
    Compound: microglobulin MHC light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1mwam_
  • Chain 'P':
    Compound: dEV8
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'Q':
    Compound: dEV8
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NAG, GOL, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mwaA (A:)
    qsvtqpdarvtvsegaslqlrckysysatpylfwyvqyprqglqlllkyysgdpvvqgvn
    gfeaefsksnssfhlrkasvhwsdsavyfcavsgfasaltfgsgtkvivlpyiqnpepav
    yalkdprsqdstlclftdfdsqinvpktmesgtfitdatvldmkamdsksngaiawsnqt
    sftcqdifketnatypssdvpc
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mwaB (B:)
    eaavtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdi
    pdgykasrpsqenfslilelatpsqtsvyfcasggggtlyfgagtrlsvledlrnvtppk
    vslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpqaykesnysy
    clssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaeawgradc
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mwaC (C:)
    qsvtqpdarvtvsegaslqlrckysysatpylfwyvqyprqglqlllkyysgdpvvqgvn
    gfeaefsksnssfhlrkasvhwsdsavyfcavsgfasaltfgsgtkvivlpyiqnpepav
    yalkdprsqdstlclftdfdsqinvpktmesgtfitdatvldmkamdsksngaiawsnqt
    sftcqdifketnatypssdvpc
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mwaD (D:)
    eaavtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdi
    pdgykasrpsqenfslilelatpsqtsvyfcasggggtlyfgagtrlsvledlrnvtppk
    vslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpqaykesnysy
    clssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaeawgradc
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1mwaH (H:)
    gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
    eretqkakgneqsfrvslrtllgyynqsaggshtiqvisgcevgsdgrllrgyqqyaydg
    cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
    rtdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgt
    fqkwasvvvplgkeqyytchvyhqglpepltlrwr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mwaH (H:)
    gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
    eretqkakgneqsfrvslrtllgyynqsaggshtiqvisgcevgsdgrllrgyqqyaydg
    cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
    rtdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgt
    fqkwasvvvplgkeqyytchvyhqglpepltlrw
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1mwaI (I:)
    gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
    eretqkakgneqsfrvslrtllgyynqsaggshtiqvisgcevgsdgrllrgyqqyaydg
    cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
    rtdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgt
    fqkwasvvvplgkeqyytchvyhqglpepltlrwr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mwaI (I:)
    gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
    eretqkakgneqsfrvslrtllgyynqsaggshtiqvisgcevgsdgrllrgyqqyaydg
    cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
    rtdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgt
    fqkwasvvvplgkeqyytchvyhqglpepltlrw
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mwaL (L:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mwaM (M:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.