PDB entry 1mvk

View 1mvk on RCSB PDB site
Description: X-ray structure of the tetrameric mutant of the B1 domain of streptococcal protein G
Class: protein binding
Keywords: strand-exchanged tetramer, channel, PROTEIN BINDING
Deposited on 2002-09-25, released 2002-10-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: immunoglobulin g binding protein g
    Species: Streptococcus sp. 'group G' [TaxId:1320]
    Gene: spg
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06654 (1-55)
      • initiating met (0)
      • engineered (1)
      • engineered (4)
      • engineered (25)
      • engineered (29)
      • engineered (32-33)
    Domains in SCOPe 2.07: d1mvka_
  • Chain 'B':
    Compound: immunoglobulin g binding protein g
    Species: Streptococcus sp. 'group G' [TaxId:1320]
    Gene: spg
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06654 (1-55)
      • initiating met (0)
      • engineered (1)
      • engineered (4)
      • engineered (25)
      • engineered (29)
      • engineered (32-33)
    Domains in SCOPe 2.07: d1mvkb_
  • Chain 'C':
    Compound: immunoglobulin g binding protein g
    Species: Streptococcus sp. 'group G' [TaxId:1320]
    Gene: spg
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06654 (1-55)
      • initiating met (0)
      • engineered (1)
      • engineered (4)
      • engineered (25)
      • engineered (29)
      • engineered (32-33)
    Domains in SCOPe 2.07: d1mvkc_
  • Chain 'D':
    Compound: immunoglobulin g binding protein g
    Species: Streptococcus sp. 'group G' [TaxId:1320]
    Gene: spg
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06654 (1-55)
      • initiating met (0)
      • engineered (1)
      • engineered (4)
      • engineered (25)
      • engineered (29)
      • engineered (32-33)
    Domains in SCOPe 2.07: d1mvkd_
  • Chain 'E':
    Compound: immunoglobulin g binding protein g
    Species: Streptococcus sp. 'group G' [TaxId:1320]
    Gene: spg
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06654 (1-55)
      • initiating met (0)
      • engineered (1)
      • engineered (4)
      • engineered (25)
      • engineered (29)
      • engineered (32-33)
    Domains in SCOPe 2.07: d1mvke_
  • Chain 'F':
    Compound: immunoglobulin g binding protein g
    Species: Streptococcus sp. 'group G' [TaxId:1320]
    Gene: spg
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06654 (1-55)
      • initiating met (0)
      • engineered (1)
      • engineered (4)
      • engineered (25)
      • engineered (29)
      • engineered (32-33)
    Domains in SCOPe 2.07: d1mvkf_
  • Chain 'G':
    Compound: immunoglobulin g binding protein g
    Species: Streptococcus sp. 'group G' [TaxId:1320]
    Gene: spg
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06654 (1-55)
      • initiating met (0)
      • engineered (1)
      • engineered (4)
      • engineered (25)
      • engineered (29)
      • engineered (32-33)
    Domains in SCOPe 2.07: d1mvkg_
  • Chain 'H':
    Compound: immunoglobulin g binding protein g
    Species: Streptococcus sp. 'group G' [TaxId:1320]
    Gene: spg
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06654 (1-55)
      • initiating met (0)
      • engineered (1)
      • engineered (4)
      • engineered (25)
      • engineered (29)
      • engineered (32-33)
    Domains in SCOPe 2.07: d1mvkh_
  • Chain 'I':
    Compound: immunoglobulin g binding protein g
    Species: Streptococcus sp. 'group G' [TaxId:1320]
    Gene: spg
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06654 (1-55)
      • initiating met (0)
      • engineered (1)
      • engineered (4)
      • engineered (25)
      • engineered (29)
      • engineered (32-33)
    Domains in SCOPe 2.07: d1mvki_
  • Chain 'J':
    Compound: immunoglobulin g binding protein g
    Species: Streptococcus sp. 'group G' [TaxId:1320]
    Gene: spg
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06654 (1-55)
      • initiating met (0)
      • engineered (1)
      • engineered (4)
      • engineered (25)
      • engineered (29)
      • engineered (32-33)
    Domains in SCOPe 2.07: d1mvkj_
  • Chain 'K':
    Compound: immunoglobulin g binding protein g
    Species: Streptococcus sp. 'group G' [TaxId:1320]
    Gene: spg
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06654 (1-55)
      • initiating met (0)
      • engineered (1)
      • engineered (4)
      • engineered (25)
      • engineered (29)
      • engineered (32-33)
    Domains in SCOPe 2.07: d1mvkk_
  • Chain 'L':
    Compound: immunoglobulin g binding protein g
    Species: Streptococcus sp. 'group G' [TaxId:1320]
    Gene: spg
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06654 (1-End)
      • initiating met (0)
      • engineered (1)
      • engineered (4)
      • engineered (25)
      • engineered (29)
      • engineered (32-33)
    Domains in SCOPe 2.07: d1mvkl_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mvkA (A:)
    mqykvilngktlkgettteavdaatfekvvkqffndngvdgewtyddatktftvte
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mvkA (A:)
    mqykvilneavdaatfekvvkqffndngvdgewtyddatktftvte
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mvkB (B:)
    mqykvilngktlkgettteavdaatfekvvkqffndngvdgewtyddatktftvte
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mvkB (B:)
    mqykvilneavdaatfekvvkqffndngvdgewtyddatktftvte
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1mvkC (C:)
    mqykvilngktlkgettteavdaatfekvvkqffndngvdgewtyddatktftvte
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mvkC (C:)
    mqykvilneavdaatfekvvkqffndngvdgewtyddatktftvte
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1mvkD (D:)
    mqykvilngktlkgettteavdaatfekvvkqffndngvdgewtyddatktftvte
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mvkD (D:)
    mqykvilnavdaatfekvvkqffndngvdgewtyddatktftvte
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1mvkE (E:)
    mqykvilngktlkgettteavdaatfekvvkqffndngvdgewtyddatktftvte
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mvkE (E:)
    mqykvilngvdaatfekvvkqffndngvdgewtyddatktftvte
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1mvkF (F:)
    mqykvilngktlkgettteavdaatfekvvkqffndngvdgewtyddatktftvte
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mvkF (F:)
    mqykvilneavdaatfekvvkqffndngvdgewtyddatktftvte
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1mvkG (G:)
    mqykvilngktlkgettteavdaatfekvvkqffndngvdgewtyddatktftvte
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mvkG (G:)
    mqykvilngeavdaatfekvvkqffndngvdgewtyddatktftvte
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1mvkH (H:)
    mqykvilngktlkgettteavdaatfekvvkqffndngvdgewtyddatktftvte
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mvkH (H:)
    mqykvilngktteavdaatfekvvkqffndngvdgewtyddatktftvte
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1mvkI (I:)
    mqykvilngktlkgettteavdaatfekvvkqffndngvdgewtyddatktftvte
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mvkI (I:)
    mqykvilngteavdaatfekvvkqffndngvdgewtyddatktftvte
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1mvkJ (J:)
    mqykvilngktlkgettteavdaatfekvvkqffndngvdgewtyddatktftvte
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mvkJ (J:)
    mqykvilneavdaatfekvvkqffndngvdgewtyddatktftvte
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1mvkK (K:)
    mqykvilngktlkgettteavdaatfekvvkqffndngvdgewtyddatktftvte
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mvkK (K:)
    mqykvilneavdaatfekvvkqffndngvdgewtyddatktftvte
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1mvkL (L:)
    mqykvilngktlkgettteavdaatfekvvkqffndngvdgewtyddatktftvte
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mvkL (L:)
    mqykvilnteavdaatfekvvkqffndngvdgewtyddatktftvt