PDB entry 1muz

View 1muz on RCSB PDB site
Description: nmr structure of the tumor suppressor bin1: alternative splicing in melanoma and interaction with c-myc
Class: endocytosis/exocytosis
Keywords: tumor suppressor, endocytosis/exocytosis complex
Deposited on 2002-09-24, released 2003-09-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myc box dependent interacting protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00499 (0-80)
      • see remark 999 (63)
    Domains in SCOPe 2.06: d1muza_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1muzA (A:)
    grldlppgfmfkvqaqhdytatdtdelqlkagdvvlvipfqnpeeqdegwlmgvkesdwn
    qhkklekcrgvfpenftervp