PDB entry 1muo

View 1muo on RCSB PDB site
Description: crystal structure of aurora-2, an oncogenic serine-threonine kinase
Class: transferase
Keywords: transferase
Deposited on 2002-09-24, released 2003-04-15
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.24
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aurora-related kinase 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1muoa_
  • Heterogens: ADN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1muoA (A:)
    ennpeeelaskqkneeskkrqwaledfeigrplgkgkfgnvylarekqskfilalkvlfk
    aqlekagvehqlrreveiqshlrhpnilrlygyfhdatrvylileyaplgtvyrelqkls
    kfdeqrtatyitelanalsychskrvihrdikpenlllgsagelkiadfgwsvhapssrr
    ttlcgtldylppemiegrmhdekvdlwslgvlcyeflvgkppfeantyqetykrisrvef
    tfpdfvtegardlisrllkhnpsqrpmlrevlehpwitansskpsncqnkesaskqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1muoA (A:)
    waledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreveiqsh
    lrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanalsyc
    hskrvihrdikpenlllgsagelkiadfgwslcgtldylppemiegrmhdekvdlwslgv
    lcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrllkhnpsqrpmlrev
    lehpwitanss