PDB entry 1muj

View 1muj on RCSB PDB site
Description:
Deposited on 2002-09-23, released 2003-02-18
The last revision prior to the SCOP 1.67 freeze date was dated 2003-02-18, with a file datestamp of 2003-02-18.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.22
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1muja1, d1muja2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1mujb1, d1mujb2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mujA (A:)
    eddieadhvgtygisvyqspgdigqytfefdgdelfyvdldkketvwmlpefgqlasfdp
    qgglqniavvkhnlgvltkrsnstpatneapqatvfpkspvllgqpntlicfvdnifppv
    initwlrnsksvadgvyetsffvnrdysfhklsyltfipsdddiydckvehwgleepvlk
    hwssadlvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mujA (A:)
    dieadhvgtygisvyqspgdigqytfefdgdelfyvdldkketvwmlpefgqlasfdpqg
    glqniavvkhnlgvltkrsnstpatneapqatvfpkspvllgqpntlicfvdnifppvin
    itwlrnsksvadgvyetsffvnrdysfhklsyltfipsdddiydckvehwgleepvlkhw
    ssadl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mujB (B:)
    gdserhfvyqfmgecyftngtqriryvtryiynreeyvrydsdvgehravtelgrpdaey
    wnsqpeilertraeldtvcrhnyegpethtslrrleqpnvvislsrtealnhhntlvcsv
    tdfypakikvrwfrngqeetvgvsstqlirngdwtfqvlvmlemtprrgevytchvehps
    lkspitvewssaelvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mujB (B:)
    serhfvyqfmgecyftngtqriryvtryiynreeyvrydsdvgehravtelgrpdaeywn
    sqpeilertraeldtvcrhnyegpethtslrrleqpnvvislshntlvcsvtdfypakik
    vrwfrngqeetvgvsstqlirngdwtfqvlvmlemtprrgevytchvehpslkspitvew
    ssae