PDB entry 1mtr

View 1mtr on RCSB PDB site
Description: hiv-1 protease complexed with a cyclic phe-ile-val peptidomimetic inhibitor
Deposited on 1996-02-15, released 1996-08-01
The last revision prior to the SCOP 1.55 freeze date was dated 1996-08-01, with a file datestamp of 1996-08-02.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.179
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1mtra_
  • Chain 'B':
    Domains in SCOP 1.55: d1mtrb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mtrA (A:)
    pqitlwkrplvtiriggqlkealldtgaddtvieemnlpgkwkpkmiggiggfikvrqyd
    qipveixghkaigtvlvgptpvniigrnlltqigxtlnf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mtrA (A:)
    pqitlwkrplvtiriggqlkealldtgaddtvieemnlpgkwkpkmiggiggfikvrqyd
    qipveighkaigtvlvgptpvniigrnlltqigtlnf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mtrB (B:)
    pqitlwkrplvtiriggqlkealldtgaddtvieemnlpgkwkpkmiggiggfikvrqyd
    qipveixghkaigtvlvgptpvniigrnlltqigxtlnf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mtrB (B:)
    pqitlwkrplvtiriggqlkealldtgaddtvieemnlpgkwkpkmiggiggfikvrqyd
    qipveighkaigtvlvgptpvniigrnlltqigtlnf