PDB entry 1mt9

View 1mt9 on RCSB PDB site
Description: Viability of a drug-resistant HIV-1 protease mutant: structural insights for better antiviral therapy
Class: hydrolase/hydrolase substrate
Keywords: Matrix, Capsid, Gag cleavage, drug resistance, substrate recognition, HYDROLASE, HYDROLASE-HYDROLASE SUBSTRATE COMPLEX
Deposited on 2002-09-20, released 2003-01-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protease retropepsin
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03369 (0-98)
      • engineered (6)
      • engineered (24)
      • engineered (81)
    Domains in SCOPe 2.07: d1mt9a_
  • Chain 'B':
    Compound: protease retropepsin
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03369 (0-98)
      • engineered (6)
      • engineered (24)
      • engineered (81)
    Domains in SCOPe 2.07: d1mt9b_
  • Chain 'P':
    Compound: p1-p6 Gag substrate decapeptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1MT9 (0-9)
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mt9A (A:)
    pqitlwkrplvtiriggqlkeallntgaddtvleemnlpgkwkpkmiggiggfikvrqyd
    qipveicghkaigtvlvgptpaniigrnlltqigctlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mt9B (B:)
    pqitlwkrplvtiriggqlkeallntgaddtvleemnlpgkwkpkmiggiggfikvrqyd
    qipveicghkaigtvlvgptpaniigrnlltqigctlnf
    

  • Chain 'P':
    No sequence available.