PDB entry 1msm
View 1msm on RCSB PDB site
Description: The HIV protease (mutant Q7K L33I L63I) complexed with KNI-764 (an inhibitor)
Class: hydrolase/hydrolase inhibitor
Keywords: HIV, KNI-764, protease, drug target, HYDROLASE, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on
2002-09-19, released
2003-11-04
The last revision prior to the SCOPe 2.08 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.209
AEROSPACI score: 0.44
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Pol polyprotein
Species: Human immunodeficiency virus 1 [TaxId:11676]
Database cross-references and differences (RAF-indexed):
- Uniprot P03367 (0-98)
- engineered (6)
- engineered (32)
- engineered (62)
Domains in SCOPe 2.08: d1msma_ - Chain 'B':
Compound: Pol polyprotein
Species: Human immunodeficiency virus 1 [TaxId:11676]
Database cross-references and differences (RAF-indexed):
- Uniprot P03367 (0-98)
- engineered (6)
- engineered (32)
- engineered (62)
Domains in SCOPe 2.08: d1msmb_ - Heterogens: JE2, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1msmA (A:)
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieicghkaigtvlvgptpvniigrnlltqigctlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1msmB (B:)
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieicghkaigtvlvgptpvniigrnlltqigctlnf