PDB entry 1msm

View 1msm on RCSB PDB site
Description: The HIV protease (mutant Q7K L33I L63I) complexed with KNI-764 (an inhibitor)
Class: hydrolase/hydrolase inhibitor
Keywords: HIV, KNI-764, protease, drug target, HYDROLASE, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2002-09-19, released 2003-11-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.209
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Pol polyprotein
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03367 (0-98)
    • engineered (6)
    • engineered (32)
    • engineered (62)
  Domains in SCOPe 2.08: d1msma_
• Chain 'B':
  Compound: Pol polyprotein
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03367 (0-98)
    • engineered (6)
    • engineered (32)
    • engineered (62)
  Domains in SCOPe 2.08: d1msmb_
• Heterogens: JE2, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1msmA (A:)
  pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
  qiiieicghkaigtvlvgptpvniigrnlltqigctlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1msmB (B:)
  pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
  qiiieicghkaigtvlvgptpvniigrnlltqigctlnf