PDB entry 1mse

View 1mse on RCSB PDB site
Description: solution structure of a specific DNA complex of the myb DNA-binding domain with cooperative recognition helices
Class: DNA binding protein/DNA
Keywords: DNA, nmr, double helix, c-myb DNA-binding domain, protooncogene product
Deposited on 1995-01-24, released 1995-03-31
The last revision prior to the SCOP 1.73 freeze date was dated 1995-03-31, with a file datestamp of 2007-06-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA (5'-d(*cp*cp*tp*ap*ap*cp*tp*gp*ap*cp*ap*cp*ap*cp*ap*t)-3')
    Species: synthetic, synthetic
  • Chain 'B':
    Compound: DNA (5'-d(*ap*tp*gp*tp*gp*tp*gp*tp*cp*ap*gp*tp*tp*ap*gp*g)-3')
    Species: synthetic, synthetic
  • Chain 'C':
    Compound: C-Myb DNA-Binding Domain
    Species: MUSCULUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1msec1, d1msec2

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mseC (C:)
    mlikgpwtkeedqrviklvqkygpkrwsviakhlkgrigkqcrerwhnhlnpevkktswt
    eeedriiyqahkrlgnrwaeiakllpgrtdnaiknhwnstmrrkv