PDB entry 1mrv

View 1mrv on RCSB PDB site
Description: crystal structure of an inactive Akt2 kinase domain
Class: transferase
Keywords: AGC serine threonine kinase, AKT PKB kinase domain, tumorigenesis, x-ray crystal structure, signal transduction
Deposited on 2002-09-18, released 2003-09-23
The last revision prior to the SCOP 1.73 freeze date was dated 2003-09-23, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.247
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RAC-beta serine/threonine kinase
    Species: HOMO SAPIENS
    Gene: AKT2
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1mrva_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mrvA (A:)
    arakvtmndfdylkllgkgtfgkvilvrekatgryyamkilrkeviiakdevahtvtesr
    vlqntrhpfltalkyafqthdrlcfvmeyanggelffhlsrervfteerarfygaeivsa
    leylhsrdvvyrdiklenlmldkdghikitdfglckegisdgatmktfcgtpeylapevl
    edndygravdwwglgvvmyemmcgrlpfynqdherlfelilmeeirfprtlspeakslla
    gllkkdpkqrlgggpsdakevmehrfflsinwqdvvqkkllppfkpqvtsevdtryfdde
    ftaqsititppdrydslglleldqrthfpqfsysasire
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mrvA (A:)
    vtmndfdylkllgkgtfgkvilvrekatgryyamkilrkevivlqntrhpfltalkyafq
    thdrlcfvmeyanggelffhlsrervfteerarfygaeivsaleylhsrdvvyrdiklen
    lmldkdghikitdfpeylapevledndygravdwwglgvvmyemmcgrlpfynqdherlf
    elilmeeirfprtlspeaksllagllkkdpkqrlgggpsdakevmehrfflsinwqdvvq
    kkllppfkpqvtsevdtryfd