PDB entry 1mru

View 1mru on RCSB PDB site
Description: Intracellular Ser/Thr protein kinase domain of Mycobacterium tuberculosis PknB.
Class: transferase
Keywords: regulatory, ATP-recognition, molecular evolution, Structural Genomics, PSI, Protein Structure Initiative, TB Structural Genomics Consortium, TBSGC, TRANSFERASE
Deposited on 2002-09-18, released 2003-02-11
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.232
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable serine/threonine-protein kinase pknB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1mrua_
  • Chain 'B':
    Compound: Probable serine/threonine-protein kinase pknB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1mrub_
  • Heterogens: MG, AGS

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mruA (A:)
    gshmttpshlsdryelgeilgfggmsevhlardlrlhrdvavkvlradlardpsfylrfr
    reaqnaaalnhpaivavydtgeaetpagplpyivmeyvdgvtlrdivhtegpmtpkraie
    viadacqalnfshqngiihrdvkpanimisatnavkvmdfgiaraiadsgnsvtqtaavi
    gtaqylspeqargdsvdarsdvyslgcvlyevltgeppftgdspvsvayqhvredpipps
    arheglsadldavvlkalaknpenryqtaaemradlvrvhngeppeapkvltdaertsll
    ssaagnlsgpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mruA (A:)
    tpshlsdryelgeilgfggmsevhlardlrlhrdvavkvlradlardpsfylrfrreaqn
    aaalnhpaivavydtgeaetpagplpyivmeyvdgvtlrdivhtegpmtpkraieviada
    cqalnfshqngiihrdvkpanimisatnavkvmdfgiaraitaqylspeqargdsvdars
    dvyslgcvlyevltgeppftgdspvsvayqhvredpippsarheglsadldavvlkalak
    npenryqtaaemradlvrvhngeppeapk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mruB (B:)
    gshmttpshlsdryelgeilgfggmsevhlardlrlhrdvavkvlradlardpsfylrfr
    reaqnaaalnhpaivavydtgeaetpagplpyivmeyvdgvtlrdivhtegpmtpkraie
    viadacqalnfshqngiihrdvkpanimisatnavkvmdfgiaraiadsgnsvtqtaavi
    gtaqylspeqargdsvdarsdvyslgcvlyevltgeppftgdspvsvayqhvredpipps
    arheglsadldavvlkalaknpenryqtaaemradlvrvhngeppeapkvltdaertsll
    ssaagnlsgpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mruB (B:)
    mttpshlsdryelgeilgfggmsevhlardlrlhrdvavkvlradlardpsfylrfrrea
    qnaaalnhpaivavydtgeaetpagplpyivmeyvdgvtlrdivhtegpmtpkraievia
    dacqalnfshqngiihrdvkpanimisatnavkvmdfgiaraitaqylspeqargdsvda
    rsdvyslgcvlyevltgeppftgdspvsvayqhvredpippsarheglsadldavvlkal
    aknpenryqtaaemradlvrvhngeppeapk