PDB entry 1mrd

View 1mrd on RCSB PDB site
Description: preparation, characterization and crystallization of an antibody fab fragment that recognizes rna. crystal structures of native fab and three fab-mononucleotide complexes
Deposited on 1994-06-13, released 1995-02-14
The last revision prior to the SCOP 1.63 freeze date was dated 1995-02-14, with a file datestamp of 1995-02-17.
Experiment type: -
Resolution: 2.3 Å
R-factor: 0.195
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1mrdH (H:)
    vqlqqsgaelvkpgasvklsckasgytftsywmqwvkqrpgqglewigeidpsdsytnyn
    qkfkgkatltvdtssstaymqlssltsedsavyycanlrgyfdywgqgttltvssakttp
    psvyplapgcgdttgssvtlgclvkgyfpesvtvtwnsgslsssvhtfpallqsglytms
    ssvtvpsstwpsqtvtcsvahpassttvdkklep
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mrdH (H:)
    vqlqqsgaelvkpgasvklsckasgytftsywmqwvkqrpgqglewigeidpsdsytnyn
    qkfkgkatltvdstaymqlssltsedsavyycanlrgyfdywgqgttltvssakttppsv
    yplapgttgssvtlgclvkgyfpesvtvtwnsgslsssvhtfpallqsglytmsssvtvp
    sstwpsqtvtcsvahpassttvdkklep
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mrdL (L:)
    dvvmtqtplslpvslgdqasiscrssqslvhsngntylhwylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvprtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgkerqngvlnswtdqnskdstysm
    sstltltkdeyerhnsytceathktstspivksfnr