PDB entry 1mrc

View 1mrc on RCSB PDB site
Description: preparation, characterization and crystallization of an antibody fab fragment that recognizes RNA. crystal structures of native fab and three fab-mononucleotide complexes
Class: immunoglobulin
Keywords: immunoglobulin
Deposited on 1994-06-13, released 1995-02-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-08-25, with a file datestamp of 2009-08-21.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.191
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: igg2b-kappa jel103 fab (heavy chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAA51630 (1-214)
      • conflict (12)
      • conflict (15)
      • conflict (19)
      • conflict (24)
      • conflict (30)
      • conflict (33-34)
      • conflict (38)
      • conflict (42)
      • conflict (49-50)
      • conflict (55-56)
      • conflict (61-62)
      • conflict (71)
      • conflict (92)
      • conflict (94)
      • conflict (98-100)
      • conflict (104)
      • conflict (140)
      • conflict (151)
    Domains in SCOPe 2.06: d1mrch1, d1mrch2
  • Chain 'L':
    Compound: igg2b-kappa jel103 fab (light chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PIR PC4203 (0-End)
      • conflict (2)
      • conflict (26)
      • conflict (26)
      • conflict (38)
      • conflict (91)
      • conflict (93)
      • conflict (95-96)
      • conflict (157)
      • conflict (171)
    Domains in SCOPe 2.06: d1mrcl1, d1mrcl2
  • Heterogens: ZN, SO4, IMD, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1mrcH (H:)
    qvqlqqsgaelvkpgasvklsckasgytftsywmqwvkqrpgqglewigeidpsdsytny
    nqkfkgkatltvdtssstaymqlssltsedsavyycanlrgyfdywgqgttltvssaktt
    ppsvyplapgcgdttgssvtlgclvkgyfpesvtvtwnsgslsssvhtfpallqsglytm
    sssvtvpsstwpsqtvtcsvahpassttvdkklep
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mrcH (H:)
    qvqlqqsgaelvkpgasvklsckasgytftsywmqwvkqrpgqglewigeisytnynqkf
    kgkatltvdstaymqlssltsedsavyycanlrgyfdywgqgttltvssakttppsvypl
    apttgssvtlgclvkgyfpesvtvtwnsgslsssvhtfpallqsglytmsssvtvpsstw
    psqtvtcsvahpassttvdkklep
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1mrcL (L:)
    dvvmtqtplslpvslgdqasiscrssqslvhsngntylhwylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvprtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgkerqngvlnswtdqnskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mrcL (L:)
    dvvmtqtplslpvslgdqasiscrssqslvhsngntylhwylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvprtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgkerqngvlnswtdqnskdstysm
    sstltltkdeyerhnsytceathktstspivksfnr