PDB entry 1mr5

View 1mr5 on RCSB PDB site
Description: Orthorhombic form of Trypanosoma cruzi trans-sialidase
Class: hydrolase
Keywords: transglycosylation, beta-propeller, protein-carbohydrate interactions, sialidase
Deposited on 2002-09-18, released 2003-03-18
The last revision prior to the SCOP 1.73 freeze date was dated 2003-03-18, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.221
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Trans-sialidase
    Species: Trypanosoma cruzi
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q26966
      • engineered (71)
      • see remark 999 (275)
      • see remark 999 (489)
      • see remark 999 (497)
      • engineered (508-509)
      • engineered (533)
      • see remark 999 (571)
      • engineered (606)
      • engineered (610)
      • engineered (612)
    Domains in SCOP 1.73: d1mr5a1, d1mr5a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mr5A (A:)
    mggshhhhhhgmaslapgssrvelfkrqsskvpfekdgkvtervvhsfrlpalvnvdgvm
    vaiadaryetsfdnslidtvakysvddgetwetqiaiknsrassvsrvvdptvivkgnkl
    yvlvgsynssrsywtshgdardwdillavgevtkstaggkitasikwgspvslkeffpae
    megmhtnqflggagvaivasngnlvypvqvtnkkkqvfskifysedegktwkfgkgrsaf
    gcsepvalewegkliintrvdyrrrlvyessdmgntwleavgtlsrvwgpspksnqpgsq
    ssftavtiegmrvmlfthplnfkgrwlrdrlnlwltdnqriynvgqvsigdensayssvl
    ykddklyclheinsnevyslvfarlvgelriiksvlqswknwdshlssictpadpaasss
    ergcgpavttvglvgflshsatktewedayrcvnastanaervpnglkfagvgggalwpv
    sqqgqnqryhfanhaftlvasvtihevpkgaspllgasldssggkkllglsydkrhqwqp
    iygstpvtptgswemgkryhvvltmankigsvyidgeplegsgqtvvpdertpdishfyv
    ggykrsgmptdsrvtvnnvllynrqlnaeeirtlflsqdligteahmd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mr5A (A:)
    gssrvelfkrqsskvpfekdgkvtervvhsfrlpalvnvdgvmvaiadaryetsfdnsli
    dtvakysvddgetwetqiaiknsrassvsrvvdptvivkgnklyvlvgsynssrsywtsh
    gdardwdillavgevtkstaggkitasikwgspvslkeffpaemegmhtnqflggagvai
    vasngnlvypvqvtnkkkqvfskifysedegktwkfgkgrsafgcsepvalewegkliin
    trvdyrrrlvyessdmgntwleavgtlsrvwgpspksnqpgsqssftavtiegmrvmlft
    hplnfkgrwlrdrlnlwltdnqriynvgqvsigdensayssvlykddklyclheinsnev
    yslvfarlvgelriiksvlqswknwdshlssictpagcgpavttvglvgflshsatktew
    edayrcvnastanaervpnglkfagvgggalwpvsqqgqnqryhfanhaftlvasvtihe
    vpkgaspllgasldssggkkllglsydkrhqwqpiygstpvtptgswemgkryhvvltma
    nkigsvyidgeplegsgqtvvpdertpdishfyvggykrsgmptdsrvtvnnvllynrql
    naeeirtlflsqdligteahm