PDB entry 1mqa

View 1mqa on RCSB PDB site
Description: Crystal structure of high affinity alphaL I domain in the absence of ligand or metal
Class: immune system
Keywords: Designed disulfide bridge, Rossmann fold, IMMUNE SYSTEM
Deposited on 2002-09-15, released 2003-01-14
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.249
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Integrin alpha-L
    Species: Homo sapiens [TaxId:9606]
    Gene: LFA-1 (AlphaLbeta2)
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20701 (1-End)
      • cloning artifact (0)
      • engineered (160)
      • engineered (167)
    Domains in SCOPe 2.03: d1mqaa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mqaA (A:)
    mgnvdlvflfdgsmslqpdefqkildfmkdvmkklsntsyqfaavqfstsyktefdfsdy
    vkrkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeatdsg
    nidaakdiiryiigigkhfqtkesqetlhkfaskpasefvcildtfeclkdlftelqkki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mqaA (A:)
    mgnvdlvflfdgsmslqpdefqkildfmkdvmkklsntsyqfaavqfstsyktefdfsdy
    vkrkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeatdsg
    nidaakdiiryiigigkhfqtkesqetlhkfaskpasefvcildtfeclkdlft