PDB entry 1mq8

View 1mq8 on RCSB PDB site
Description: Crystal structure of alphaL I domain in complex with ICAM-1
Class: immune system
Keywords: Ig superfamily, Rossmann fold, metal mediated protein interface, IMMUNE SYSTEM
Deposited on 2002-09-15, released 2003-01-14
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: 0.264
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: intercellular adhesion molecule-1
    Species: Homo sapiens [TaxId:9606]
    Gene: ICAM-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1mq8a1, d1mq8a2
  • Chain 'B':
    Compound: Integrin alpha-L
    Species: Homo sapiens [TaxId:9606]
    Gene: LFA-1 (AlphaLbeta2)
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20701 (0-176)
      • engineered (31)
      • engineered (169)
    Domains in SCOPe 2.03: d1mq8b_
  • Chain 'C':
    Compound: intercellular adhesion molecule-1
    Species: Homo sapiens [TaxId:9606]
    Gene: ICAM-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1mq8c1, d1mq8c2
  • Chain 'D':
    Compound: Integrin alpha-L
    Species: Homo sapiens [TaxId:9606]
    Gene: LFA-1 (AlphaLbeta2)
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20701 (0-176)
      • engineered (31)
      • engineered (169)
    Domains in SCOPe 2.03: d1mq8d_
  • Heterogens: NAG, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mq8A (A:)
    qtsvspskvilprggsvlvtcstscdqpkllgietplpkkelllpgnnrkvyelsnvqed
    sqpmcysncpdgqstaktfltvywtpervelaplpswqpvgknltlrcqveggapranlt
    vvllrgekelkrepavgepaevtttvlvrrdhhganfscrteldlrpqglelfentsapy
    qlqtfvlpatppqlvsprvlevdtqgtvvcsldglfpvseaqvhlalgdqrlnptvtygn
    dsfsakasvsvtaedegtqrltcavilgnqsqetlqtvtiysfpapnvilt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mq8A (A:)
    qtsvspskvilprggsvlvtcstscdqpkllgietplpkkelllpgnnrkvyelsnvqed
    sqpmcysncpdgqstaktfltvywtpervelaplpswqpvgknltlrcqveggapranlt
    vvllrgekelkrepavgepaevtttvlvrrdhhganfscrteldlrpqglelfentsapy
    qlqt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mq8B (B:)
    vdlvflfdgsmslqpdefqkildfmkdvmkkcsntsyqfaavqfstsyktefdfsdyvkr
    kdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeatdsgnid
    aakdiiryiigigkhfqtkesqetlhkfaskpasefvkildtfeklkdlctelqkki
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1mq8C (C:)
    qtsvspskvilprggsvlvtcstscdqpkllgietplpkkelllpgnnrkvyelsnvqed
    sqpmcysncpdgqstaktfltvywtpervelaplpswqpvgknltlrcqveggapranlt
    vvllrgekelkrepavgepaevtttvlvrrdhhganfscrteldlrpqglelfentsapy
    qlqtfvlpatppqlvsprvlevdtqgtvvcsldglfpvseaqvhlalgdqrlnptvtygn
    dsfsakasvsvtaedegtqrltcavilgnqsqetlqtvtiysfpapnvilt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mq8C (C:)
    qtsvspskvilprggsvlvtcstscdqpkllgietplpkkelllpgnnrkvyelsnvqed
    sqpmcysncpdgqstaktfltvywtpervelaplpswqpvgknltlrcqveggapranlt
    vvllrgekelkrepavgepaevtttvlvrrdhhganfscrteldlrpqglelfentsapy
    qlqt
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mq8D (D:)
    vdlvflfdgsmslqpdefqkildfmkdvmkkcsntsyqfaavqfstsyktefdfsdyvkr
    kdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeatdsgnid
    aakdiiryiigigkhfqtkesqetlhkfaskpasefvkildtfeklkdlctelqkki