PDB entry 1mpe

View 1mpe on RCSB PDB site
Description: Ensemble of 20 structures of the tetrameric mutant of the B1 domain of streptococcal protein G
Class: protein binding
Keywords: strand-exchanged tetramer, channel, PROTEIN BINDING
Deposited on 2002-09-12, released 2002-10-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: immunoglobulin g binding protein g
    Species: Streptococcus sp. 'group G' [TaxId:1320]
    Gene: spg
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06654 (1-55)
      • initiating met (0)
      • engineered (1)
      • engineered (4)
      • engineered (25)
      • engineered (29)
      • engineered (32-33)
    Domains in SCOPe 2.07: d1mpea_
  • Chain 'B':
    Compound: immunoglobulin g binding protein g
    Species: Streptococcus sp. 'group G' [TaxId:1320]
    Gene: spg
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06654 (1-55)
      • initiating met (0)
      • engineered (1)
      • engineered (4)
      • engineered (25)
      • engineered (29)
      • engineered (32-33)
    Domains in SCOPe 2.07: d1mpeb_
  • Chain 'C':
    Compound: immunoglobulin g binding protein g
    Species: Streptococcus sp. 'group G' [TaxId:1320]
    Gene: spg
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06654 (1-55)
      • initiating met (0)
      • engineered (1)
      • engineered (4)
      • engineered (25)
      • engineered (29)
      • engineered (32-33)
    Domains in SCOPe 2.07: d1mpec_
  • Chain 'D':
    Compound: immunoglobulin g binding protein g
    Species: Streptococcus sp. 'group G' [TaxId:1320]
    Gene: spg
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06654 (1-55)
      • initiating met (0)
      • engineered (1)
      • engineered (4)
      • engineered (25)
      • engineered (29)
      • engineered (32-33)
    Domains in SCOPe 2.07: d1mped_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mpeA (A:)
    mqykvilngktlkgettteavdaatfekvvkqffndngvdgewtyddatktftvte
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mpeB (B:)
    mqykvilngktlkgettteavdaatfekvvkqffndngvdgewtyddatktftvte
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mpeC (C:)
    mqykvilngktlkgettteavdaatfekvvkqffndngvdgewtyddatktftvte
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mpeD (D:)
    mqykvilngktlkgettteavdaatfekvvkqffndngvdgewtyddatktftvte