PDB entry 1moz

View 1moz on RCSB PDB site
Description: ADP-ribosylation factor-like 1 (ARL1) from Saccharomyces cerevisiae
Class: protein binding
Keywords: GTP-binding, protein binding
Deposited on 2002-09-10, released 2002-10-09
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.17 Å
R-factor: 0.206
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ADP-ribosylation factor-like protein 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1moza_
  • Chain 'B':
    Compound: ADP-ribosylation factor-like protein 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1mozb_
  • Heterogens: GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mozA (A:)
    mgnifssmfdklwgsnkelrililgldgagkttilyrlqigevvttkptigfnvetlsyk
    nlklnvwdlggqtsirpywrcyyadtaavifvvdstdkdrmstaskelhlmlqeeelqda
    allvfankqdqpgalsasevskelnlvelkdrswsivassaikgegitegldwlidvike
    eql
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mozA (A:)
    gnifssmfdklwgsnkelrililgldgagkttilyrlqigevvttkptigfnvetlsykn
    lklnvwdlgirpywrcyyadtaavifvvdstdkdrmstaskelhlmlqeeelqdaallvf
    ankqdqpgalsasevskelnlvelkdrswsivassaikgegitegldwlidvikeeql
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mozB (B:)
    mgnifssmfdklwgsnkelrililgldgagkttilyrlqigevvttkptigfnvetlsyk
    nlklnvwdlggqtsirpywrcyyadtaavifvvdstdkdrmstaskelhlmlqeeelqda
    allvfankqdqpgalsasevskelnlvelkdrswsivassaikgegitegldwlidvike
    eql
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mozB (B:)
    gnifssmfdklwgsnkelrililgldgagkttilyrlqigevvttkptigfnvetlsykn
    lklnvwdlgirpywrcyyadtaavifvvdstdkdrmstaskelhlmlqeeelqdaallvf
    ankqdqpgalsasevskelnlvelkdrswsivassaikgegitegldwlidvikeeql