PDB entry 1moo

View 1moo on RCSB PDB site
Description: Site Specific Mutant (H64A) of Human Carbonic Anhydrase II at high resolution
Class: lyase
Keywords: High-resolution, 4-methylimidazole, Twisted Beta Sheet, Zinc Metalloenzyme, LYASE
Deposited on 2002-09-09, released 2002-09-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.05 Å
R-factor: 0.157
AEROSPACI score: 0.94 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carbonic anhydrase II
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00918 (Start-259)
      • engineered (63)
    Domains in SCOPe 2.07: d1mooa_
  • Heterogens: ZN, HG, 4MZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mooA (A:)
    mshhwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslril
    nngaafnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhl
    vhwntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdp
    rgllpesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelm
    vdnwrpaqplknrqikasfk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mooA (A:)
    wgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnnga
    afnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhlvhwn
    tkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprgll
    pesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvdnw
    rpaqplknrqikasfk