PDB entry 1moh

View 1moh on RCSB PDB site
Description: ferric monomeric hemoglobin I (hb I)
Class: oxygen transport
Keywords: monomeric, hemoglobin (ferric), sulfide transport
Deposited on 1996-02-27, released 1996-08-01
The last revision prior to the SCOP 1.75 freeze date was dated 1996-08-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.186
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: monomeric hemoglobin I
  Species: Lucina pectinata
  Database cross-references and differences (RAF-indexed):
  • Uniprot P41260 (0-141)
  Domains in SCOP 1.75: d1moha_
• Heterogens: HEM, H2S, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1mohA (A:)
  sleaaqksnvtsswakasaawgtagpeffmalfdahddvfakfsglfsgaakgtvkntpe
  maaqaqsfkglvsnwvdnldnagalegqcktfaanhkargisagqleaafkvlsgfmksy
  ggdegawtavagalmgeiepdm