PDB entry 1moh

View 1moh on RCSB PDB site
Description: ferric monomeric hemoglobin i (hb i)
Deposited on 1996-02-27, released 1996-08-01
The last revision prior to the SCOP 1.57 freeze date was dated 1996-08-01, with a file datestamp of 1996-08-02.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.186
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d1moh__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1moh_ (-)
    sleaaqksnvtsswakasaawgtagpeffmalfdahddvfakfsglfsgaakgtvkntpe
    maaqaqsfkglvsnwvdnldnagalegqcktfaanhkargisagqleaafkvlsgfmksy
    ggdegawtavagalmgeiepdm