PDB entry 1mof

View 1mof on RCSB PDB site
Description: coat protein
Class: Viral protein
Keywords: GLYCOPROTEIN, COAT PROTEIN, POLYPROTEIN, TRANSMEMBRANE, SIGN, Viral protein
Deposited on 1996-04-02, released 1996-10-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.169
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: moloney murine leukemia virus p15
    Species: Moloney murine leukemia virus [TaxId:11801]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03385 (Start-54)
      • see remark 7 (50)
    Domains in SCOPe 2.07: d1mofa_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mofA (A:)
    mddlreveksisnleksltslsevvlqnrrgldllflkegglcaalkeecafyad
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mofA (A:)
    dlreveksisnleksltslsevvlqnrrgldllflkegglcaalkeecafyad