PDB entry 1moe

View 1moe on RCSB PDB site
Description: the three-dimensional structure of an engineered scfv t84.66 dimer or diabody in vl to vh linkage.
Deposited on 2002-09-09, released 2003-03-18
The last revision prior to the SCOP 1.69 freeze date was dated 2003-03-18, with a file datestamp of 2003-03-18.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.213
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1moeA (A:)
    divltqspaslavslgqratmscragesvdifgvgflhwyqqkpgqppklliyrasnles
    gipvrfsgtgsrtdftliidpveaddvatyycqqtnedpytfgggtkleikgggsgggge
    vqlqqsgaelvepgasvklsctasgfnikdtymhwvkqrpeqglewigridpangnskyv
    pkfqgkatitadtssntaylqltsltsedtavyycapfgyyvsdyamaywgqgtsvtvss
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1moeB (B:)
    divltqspaslavslgqratmscragesvdifgvgflhwyqqkpgqppklliyrasnles
    gipvrfsgtgsrtdftliidpveaddvatyycqqtnedpytfgggtkleikgggsgggge
    vqlqqsgaelvepgasvklsctasgfnikdtymhwvkqrpeqglewigridpangnskyv
    pkfqgkatitadtssntaylqltsltsedtavyycapfgyyvsdyamaywgqgtsvtvss