PDB entry 1mob

View 1mob on RCSB PDB site
Description: high-resolution crystal structures of distal histidine mutants of sperm whale myoglobin
Class: oxygen storage
Keywords: oxygen storage
Deposited on 1994-12-01, released 1995-02-07
The last revision prior to the SCOP 1.75 freeze date was dated 2005-05-03, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.157
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Myoglobin
  Species: Physeter catodon
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02185 (1-153)
    • conflict (64)
    • conflict (122)
  Domains in SCOP 1.75: d1moba_
• Heterogens: SO4, HEM, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1mobA (A:)
  mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
  dlkkggvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
  pgnfgadaqgamnkalelfrkdiaakykelgyqg