PDB entry 1mnh

View 1mnh on RCSB PDB site
Description: interactions among residues cd3, e7, e10 and e11 in myoglobins: attempts to simulate the o2 and co binding properties of aplysia myoglobin
Class: oxygen storage
Keywords: oxygen storage
Deposited on 1995-01-11, released 1995-05-08
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.185
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Myoglobin
  Species: Sus scrofa [TaxId:9823]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02189 (0-152)
    • conflict (63)
    • conflict (66)
  Domains in SCOPe 2.01: d1mnha_
• Heterogens: HEM, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1mnhA (A:)
  glsdgewqlvlnvwgkveadvaghgqevlirlfkghpetlekfdkfkhlksedemkased
  lkkvgnrvltalggilkkkghheaeltplaqshatkhkipvkylefiseaiiqvlqskhp
  gdfgadaqgamskalelfrndmaakykelgfqg