PDB entry 1mnh

View 1mnh on RCSB PDB site
Description: interactions among residues cd3, e7, e10 and e11 in myoglobins: attempts to simulate the o2 and co binding properties of aplysia myoglobin
Class: oxygen storage
Keywords: oxygen storage
Deposited on 1995-01-11, released 1995-05-08
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: -
Resolution: 2.3 Å
R-factor: 0.185
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Sus scrofa
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02189 (0-152)
      • conflict (63)
      • conflict (66)
    Domains in SCOP 1.73: d1mnha_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mnhA (A:)
    glsdgewqlvlnvwgkveadvaghgqevlirlfkghpetlekfdkfkhlksedemkased
    lkkvgnrvltalggilkkkghheaeltplaqshatkhkipvkylefiseaiiqvlqskhp
    gdfgadaqgamskalelfrndmaakykelgfqg