PDB entry 1mnh

View 1mnh on RCSB PDB site
Description: interactions among residues cd3, e7, e10 and e11 in myoglobins: attempts to simulate the o2 and co binding properties of aplysia myoglobin
Deposited on 1995-01-11, released 1995-05-08
The last revision prior to the SCOP 1.55 freeze date was dated 1995-05-08, with a file datestamp of 1995-05-09.
Experiment type: -
Resolution: 2.3 Å
R-factor: 0.185
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d1mnh__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1mnh_ (-)
  glsdgewqlvlnvwgkveadvaghgqevlirlfkghpetlekfdkfkhlksedemkased
  lkkvgnrvltalggilkkkghheaeltplaqshatkhkipvkylefiseaiiqvlqskhp
  gdfgadaqgamskalelfrndmaakykelgfqg