PDB entry 1mn3

View 1mn3 on RCSB PDB site
Description: Cue domain of yeast Vps9p
Class: protein transport
Keywords: Ubiquitin, PROTEIN TRANSPORT
Deposited on 2002-09-04, released 2003-06-10
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.244
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vacuolar protein sorting-associated protein VPS9
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: VPS9
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54787 (0-53)
      • modified residue (21)
      • modified residue (25)
      • engineered (42)
    Domains in SCOPe 2.04: d1mn3a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1mn3A (A:)
sslikkieenerkdtlntlqnmfpdmdpsliedvciakksriepcvdallslse