PDB entry 1mms

View 1mms on RCSB PDB site
Description: crystal structure of the ribosomal protein l11-rna complex
Deposited on 1999-04-14, released 2000-04-17
The last revision prior to the SCOP 1.59 freeze date was dated 2000-04-17, with a file datestamp of 2000-04-17.
Experiment type: XRAY
Resolution: 2.57 Å
R-factor: 0.219
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mmsA (A:)
    qiklqlpagkatpappvgpalgqhgvnimefckrfnaetadkagmilpvvitvyedksft
    fiiktppasfllkkaagiekgssepkrkivgkvtrkqieeiaktkmpdlnansleaamki
    iegtaksmgievv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mmsB (B:)
    ktppasfllkkaagiekgssepkrkivgkvtrkqieeiaktkmpdlnansleaamkiieg
    taksmgievv