PDB entry 1mmo

View 1mmo on RCSB PDB site
Description: crystal structure of a bacterial non-haem iron hydroxylase that catalyses the biological oxidation of methane
Class: oxidoreductase (monooxygenase)
Keywords: oxidoreductase (monooxygenase)
Deposited on 1994-02-22, released 1995-02-27
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.17
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: methane monooxygenase hydrolase (beta chain)
    Species: Methylococcus capsulatus [TaxId:414]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18798 (0-383)
      • conflict (136-139)
    Domains in SCOPe 2.01: d1mmob_
  • Chain 'C':
    Compound: methane monooxygenase hydrolase (beta chain)
    Species: Methylococcus capsulatus [TaxId:414]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18798 (0-383)
      • conflict (136-139)
    Domains in SCOPe 2.01: d1mmoc_
  • Chain 'D':
    Compound: methane monooxygenase hydrolase (alpha chain)
    Species: Methylococcus capsulatus [TaxId:414]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22869 (0-511)
      • conflict (291)
      • conflict (429)
    Domains in SCOPe 2.01: d1mmod_
  • Chain 'E':
    Compound: methane monooxygenase hydrolase (alpha chain)
    Species: Methylococcus capsulatus [TaxId:414]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22869 (0-511)
      • conflict (291)
      • conflict (429)
    Domains in SCOPe 2.01: d1mmoe_
  • Chain 'G':
    Compound: methane monooxygenase hydrolase (gamma chain)
    Species: Methylococcus capsulatus [TaxId:414]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11987 (0-161)
      • conflict (34)
      • conflict (76)
    Domains in SCOPe 2.01: d1mmog_
  • Chain 'H':
    Compound: methane monooxygenase hydrolase (gamma chain)
    Species: Methylococcus capsulatus [TaxId:414]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11987 (0-161)
      • conflict (34)
      • conflict (76)
    Domains in SCOPe 2.01: d1mmoh_
  • Heterogens: FE, ACY, HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mmoB (B:)
    errrgltdpemaavilkalpeapldgnnkmgyfvtprwkrlteyealtvyaqpnadwiag
    gldwgdwtqkfhggrpswgnettelrtvdwfkhrdplrrwhapyvkdkaeewrytdrflq
    gysadgqiramnptwrtsscnrywgaflfneyglfnahsqgarealsdvtrvslafwgfd
    kidiaqmiqlergflakivpgfdestavpkaewtngevyksarlaveglwqevfdwnesa
    fsvhavydalfgqfvrreffqrlaprfgdnltpffinqaqtyfqiakqgvqdlyynclgd
    dpefsdynrtvmrnwtgkwleptiaalrdfmglfaklpagttdkeeitaslyrvvddwie
    dyasaidfkadrdqivkavlaglk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mmoC (C:)
    errrgltdpemaavilkalpeapldgnnkmgyfvtprwkrlteyealtvyaqpnadwiag
    gldwgdwtqkfhggrpswgnettelrtvdwfkhrdplrrwhapyvkdkaeewrytdrflq
    gysadgqiramnptwrtsscnrywgaflfneyglfnahsqgarealsdvtrvslafwgfd
    kidiaqmiqlergflakivpgfdestavpkaewtngevyksarlaveglwqevfdwnesa
    fsvhavydalfgqfvrreffqrlaprfgdnltpffinqaqtyfqiakqgvqdlyynclgd
    dpefsdynrtvmrnwtgkwleptiaalrdfmglfaklpagttdkeeitaslyrvvddwie
    dyasaidfkadrdqivkavlaglk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mmoD (D:)
    aanraptsvnaqevhrwlqsfnwdfknnrtkyatkykmanetkeqfkliakeyarmeavk
    derqfgslqvaltrlnagvrvhpkwnetmkvvsnflevgeynaiaatgmlwdsaqaaeqk
    ngylaqvldeirhthqcayvnyyfakngqdpaghndarrtrtigplwkgmkrvfsdgfis
    gdavecslnlqlvgeacftnplivavtewaaangdeitptvflsietdelrhmangyqtv
    vsiandpasakylntdlnnafwtqqkyftpvlgmlfeygskfkvepwvktwdrwvyedwg
    giwigrlgkygvesprslkdakqdaywahhdlyllayalwptgffrlalpdqeemewfea
    nypgwydhygkiyeewrargcedpssgfiplmwfiennhpiyidrvsqvpfcpslakgas
    tlrvheyngemhtfsdqwgermwlaeperyecqnifeqyegrelseviaelhglrsdgkt
    liaqphvrgdklwtlddikrlncvfknpvkaf
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mmoE (E:)
    aanraptsvnaqevhrwlqsfnwdfknnrtkyatkykmanetkeqfkliakeyarmeavk
    derqfgslqvaltrlnagvrvhpkwnetmkvvsnflevgeynaiaatgmlwdsaqaaeqk
    ngylaqvldeirhthqcayvnyyfakngqdpaghndarrtrtigplwkgmkrvfsdgfis
    gdavecslnlqlvgeacftnplivavtewaaangdeitptvflsietdelrhmangyqtv
    vsiandpasakylntdlnnafwtqqkyftpvlgmlfeygskfkvepwvktwdrwvyedwg
    giwigrlgkygvesprslkdakqdaywahhdlyllayalwptgffrlalpdqeemewfea
    nypgwydhygkiyeewrargcedpssgfiplmwfiennhpiyidrvsqvpfcpslakgas
    tlrvheyngemhtfsdqwgermwlaeperyecqnifeqyegrelseviaelhglrsdgkt
    liaqphvrgdklwtlddikrlncvfknpvkaf
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mmoG (G:)
    lgihsndtrdawvnkiahvntlekaaemlkqfrmdhttpfrnsyeldndylwieakleek
    vavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykppim
    pvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvh
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mmoH (H:)
    lgihsndtrdawvnkiahvntlekaaemlkqfrmdhttpfrnsyeldndylwieakleek
    vavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykppim
    pvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvh