PDB entry 1mmb

View 1mmb on RCSB PDB site
Description: complex of bb94 with the catalytic domain of matrix metalloproteinase-8
Class: hydrolase (metalloprotease)
Keywords: hydrolase, metalloprotease, metzincins, collagen degradation, hydrolase (metalloprotease)
Deposited on 1995-08-23, released 1996-10-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.189
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: matrix metalloproteinase-8
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mmba_
  • Heterogens: CA, ZN, BAT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mmbA (A:)
    mltpgnpkwertnltyrirnytpqlseaeveraikdafelwsvaspliftrisqgeadin
    iafyqrdhgdnspfdgpngilahafqpgqgiggdahfdaeetwtntsanynlflvaahef
    ghslglahssdpgalmypnyafretsnyslpqddidgiqaiyg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mmbA (A:)
    npkwertnltyrirnytpqlseaeveraikdafelwsvaspliftrisqgeadiniafyq
    rdhgdnspfdgpngilahafqpgqgiggdahfdaeetwtntsanynlflvaahefghslg
    lahssdpgalmypnyafretsnyslpqddidgiqaiyg