PDB entry 1mlo

View 1mlo on RCSB PDB site
Description: structural and functional effects of apolar mutations of val68(e11) in myoglobin
Deposited on 1994-06-15, released 1994-08-31
The last revision prior to the SCOP 1.57 freeze date was dated 1994-08-31, with a file datestamp of 1994-09-15.
Experiment type: -
Resolution: 1.8 Å
R-factor: 0.1586
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d1mlo__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mlo_ (-)
    mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
    dlkkhgvtiltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
    pgnfgadaqgamnkalelfrkdiaakykelgyqg