PDB entry 1mln

View 1mln on RCSB PDB site
Description: structural and functional effects of apolar mutations of val68(e11) in myoglobin
Class: oxygen storage
Keywords: oxygen storage
Deposited on 1994-06-15, released 1994-08-31
The last revision prior to the SCOP 1.75 freeze date was dated 2005-05-03, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.14
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Physeter catodon
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02185 (1-153)
      • conflict (68)
      • conflict (122)
    Domains in SCOP 1.75: d1mlna_
  • Heterogens: SO4, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mlnA (A:)
    mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
    dlkkhgvtiltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
    pgnfgadaqgamnkalelfrkdiaakykelgyqg