PDB entry 1mld

View 1mld on RCSB PDB site
Description: refined structure of mitochondrial malate dehydrogenase from porcine heart and the consensus structure for dicarboxylic acid oxidoreductases
Deposited on 1994-01-24, released 1995-01-26
The last revision prior to the SCOP 1.67 freeze date was dated 1995-01-26, with a file datestamp of 1995-02-03.
Experiment type: -
Resolution: 1.9 Å
R-factor: 0.211
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mldA (A:)
    akvavlgasggigqplslllknsplvsrltlydiahtpgvaadlshietratvkgylgpe
    qlpdclkgcdvvvipagvprkpgmtrddlfntnativatltaacaqhcpdamiciisnpv
    nstipitaevfkkhgvynpnkifgvttldivranafvaelkgldparvsvpvigghagkt
    iiplisqctpkvdfpqdqlstltgriqeagtevvkakagagsatlsmayagarfvfslvd
    amngkegvvecsfvksqetdcpyfstplllgkkgieknlgigkispfeekmiaeaipelk
    asikkgeefvknmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mldA (A:)
    akvavlgasggigqplslllknsplvsrltlydiahtpgvaadlshietratvkgylgpe
    qlpdclkgcdvvvipagvprkpgmtrddlfntnativatltaacaqhcpdamiciisnpv
    nstipitaevfkkhgvynpnkifgvttldivranafvaelkgldparvsvpvigghagkt
    iiplisqctpkvdfpqdqlstltgriqeagtevvkakagagsatlsmayagarfvfslvd
    amngkegvvecsfvksqetdcpyfstplllgkkgieknlgigkispfeekmiaeaipelk
    asikkgeefvknm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mldB (B:)
    akvavlgasggigqplslllknsplvsrltlydiahtpgvaadlshietratvkgylgpe
    qlpdclkgcdvvvipagvprkpgmtrddlfntnativatltaacaqhcpdamiciisnpv
    nstipitaevfkkhgvynpnkifgvttldivranafvaelkgldparvsvpvigghagkt
    iiplisqctpkvdfpqdqlstltgriqeagtevvkakagagsatlsmayagarfvfslvd
    amngkegvvecsfvksqetdcpyfstplllgkkgieknlgigkispfeekmiaeaipelk
    asikkgeefvknmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mldB (B:)
    akvavlgasggigqplslllknsplvsrltlydiahtpgvaadlshietratvkgylgpe
    qlpdclkgcdvvvipagvprkpgmtrddlfntnativatltaacaqhcpdamiciisnpv
    nstipitaevfkkhgvynpnkifgvttldivranafvaelkgldparvsvpvigghagkt
    iiplisqctpkvdfpqdqlstltgriqeagtevvkakagagsatlsmayagarfvfslvd
    amngkegvvecsfvksqetdcpyfstplllgkkgieknlgigkispfeekmiaeaipelk
    asikkgeefvknm
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1mldC (C:)
    akvavlgasggigqplslllknsplvsrltlydiahtpgvaadlshietratvkgylgpe
    qlpdclkgcdvvvipagvprkpgmtrddlfntnativatltaacaqhcpdamiciisnpv
    nstipitaevfkkhgvynpnkifgvttldivranafvaelkgldparvsvpvigghagkt
    iiplisqctpkvdfpqdqlstltgriqeagtevvkakagagsatlsmayagarfvfslvd
    amngkegvvecsfvksqetdcpyfstplllgkkgieknlgigkispfeekmiaeaipelk
    asikkgeefvknmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mldC (C:)
    akvavlgasggigqplslllknsplvsrltlydiahtpgvaadlshietratvkgylgpe
    qlpdclkgcdvvvipagvprkpgmtrddlfntnativatltaacaqhcpdamiciisnpv
    nstipitaevfkkhgvynpnkifgvttldivranafvaelkgldparvsvpvigghagkt
    iiplisqctpkvdfpqdqlstltgriqeagtevvkakagagsatlsmayagarfvfslvd
    amngkegvvecsfvksqetdcpyfstplllgkkgieknlgigkispfeekmiaeaipelk
    asikkgeefvknm
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1mldD (D:)
    akvavlgasggigqplslllknsplvsrltlydiahtpgvaadlshietratvkgylgpe
    qlpdclkgcdvvvipagvprkpgmtrddlfntnativatltaacaqhcpdamiciisnpv
    nstipitaevfkkhgvynpnkifgvttldivranafvaelkgldparvsvpvigghagkt
    iiplisqctpkvdfpqdqlstltgriqeagtevvkakagagsatlsmayagarfvfslvd
    amngkegvvecsfvksqetdcpyfstplllgkkgieknlgigkispfeekmiaeaipelk
    asikkgeefvknmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mldD (D:)
    akvavlgasggigqplslllknsplvsrltlydiahtpgvaadlshietratvkgylgpe
    qlpdclkgcdvvvipagvprkpgmtrddlfntnativatltaacaqhcpdamiciisnpv
    nstipitaevfkkhgvynpnkifgvttldivranafvaelkgldparvsvpvigghagkt
    iiplisqctpkvdfpqdqlstltgriqeagtevvkakagagsatlsmayagarfvfslvd
    amngkegvvecsfvksqetdcpyfstplllgkkgieknlgigkispfeekmiaeaipelk
    asikkgeefvknm