PDB entry 1ml2

View 1ml2 on RCSB PDB site
Description: Crystal Structure of a Mutant Variant of Cytochrome c Peroxidase with Zn(II)-(20-oxo-Protoporphyrin IX)
Class: oxidoreductase
Keywords: Cytochrome c peroxidase, ZnCcP, Zn-Protoporphyrin IX, oxygen radical, Trp cation radical, Trp-Tyr Covalent Cross-link, OXIDOREDUCTASE
Deposited on 2002-08-29, released 2003-04-08
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.183
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cytochrome c peroxidase
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Gene: OPBYC
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00431 (0-293)
    • engineered (51)
  Domains in SCOPe 2.04: d1ml2a_
• Heterogens: ZEM, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ml2A (A:)
  ttplvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawytsgtwdkh
  dntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemq
  gpkipwrcgrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahalgkt
  hlknsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliq
  dpkylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl