PDB entry 1ml2

View 1ml2 on RCSB PDB site
Description: Crystal Structure of a Mutant Variant of Cytochrome c Peroxidase with Zn(II)-(20-oxo-Protoporphyrin IX)
Class: oxidoreductase
Keywords: Cytochrome c peroxidase, ZnCcP, Zn-Protoporphyrin IX, oxygen radical, Trp cation radical, Trp-Tyr Covalent Cross-link
Deposited on 2002-08-29, released 2003-04-08
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-08, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.183
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c peroxidase
    Species: Saccharomyces cerevisiae
    Gene: OPBYC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00431 (0-293)
      • engineered (51)
    Domains in SCOP 1.75: d1ml2a_
  • Heterogens: ZEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ml2A (A:)
ttplvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawytsgtwdkh
dntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemq
gpkipwrcgrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahalgkt
hlknsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliq
dpkylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl