PDB entry 1mky

View 1mky on RCSB PDB site
Description: Structural Analysis of the Domain Interactions in Der, a Switch Protein Containing Two GTPase Domains
Class: ligand binding protein
Keywords: GTPase, EngA, Der, KH-Domain, tandem G-domains, LIGAND BINDING PROTEIN
Deposited on 2002-08-29, released 2003-01-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-02-04, with a file datestamp of 2015-01-30.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.204
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable GTP-binding protein engA
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X1F8 (Start-438)
      • cloning artifact (70)
      • cloning artifact (77)
      • cloning artifact (155)
      • cloning artifact (283)
      • cloning artifact (287)
      • conflict (305)
      • cloning artifact (344)
      • cloning artifact (348)
      • conflict (387)
    Domains in SCOPe 2.06: d1mkya1, d1mkya2, d1mkya3
  • Heterogens: PO4, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mkyA (A:)
    matvlivgrpnvgkstlfnklvkkkkaivedeegvtrdpvqdtvewygktfklvdtcgvf
    dnpqdiisqkmkevtlnmireadlvlfvvdgkrgitkedesladflrkstvdtilvanka
    enlreferevkpelyslgfgepipvsaehninldtmletiikkleekgldleskpeitda
    ikvaivgrpnvgkstlfnailnkeralvspipgttrdpvddevfidgrkyvfvdtaglrr
    ksrveprtvekysnyrvvdsiekadvvvivldatqgitrqdqrmaglmerrgrasvvvfn
    kwdlvvhrekrydeftklfreklyfidyspliftsadkgwnidrmidamnlayasyttkv
    pssainsalqkvlaftnlprglkiffgvqvdikpptflffvnsiekvknpqkiflrklir
    dyvfpfegspiflkfkrsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mkyA (A:)
    atvlivgrpnvgkstlfnklvkdpvqdtvewygktfklvdtcgvfdnpqdiisqkmkevt
    lnmireadlvlfvvdgkrgitkedesladflrkstvdtilvankaenlreferevkpely
    slgfgepipvsaehninldtmletiikkleekgldleskpeitdaikvaivgrpnvgkst
    lfnailnkeralvspipvddevfidgrkyvfvdtaglekysnyrvvdsiekadvvvivld
    atqgitrqdqrmaglmerrgrasvvvfnkwdlvvhrekrydeftklfreklyfidyspli
    ftsadkgwnidrmidamnlayasyttkvpssainsalqkvlaftnlprglkiffgvqvdi
    kpptflffvnsiekvknpqkiflrklirdyvfpfegspiflkfkrsr