PDB entry 1mkk

View 1mkk on RCSB PDB site
Description: Disulfide deficient mutant of vascular endothelial growth factor A (C61A and C104A)
Class: hormone/growth factor
Keywords: Cystine-knot growth factor
Deposited on 2002-08-29, released 2002-12-11
The last revision prior to the SCOP 1.75 freeze date was dated 2002-12-11, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.32 Å
R-factor: 0.168
AEROSPACI score: -1.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vascular Endothelial Growth Factor A
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15692 (1-End)
      • engineered (48)
      • engineered (91)
    Domains in SCOP 1.75: d1mkka_
  • Chain 'B':
    Compound: Vascular Endothelial Growth Factor A
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15692 (1-End)
      • cloning artifact (0)
      • engineered (48)
      • engineered (91)
    Domains in SCOP 1.75: d1mkkb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mkkA (A:)
    mvvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggcandeglecvpte
    esnitmqimrikphqgqhigemsflqhnkcearpkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mkkA (A:)
    vvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggcandeglecvptee
    snitmqimrikphqgqhigemsflqhnkcearp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mkkB (B:)
    mvvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggcandeglecvpte
    esnitmqimrikphqgqhigemsflqhnkcearpkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mkkB (B:)
    mvvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggcandeglecvpte
    esnitmqimrikphqgqhigemsflqhnkcearp