PDB entry 1mkh

View 1mkh on RCSB PDB site
Description: C-terminal domain of methionyl-tRNA synthetase from Pyrococcus abyssi
Deposited on 2002-08-29, released 2003-02-04
The last revision prior to the SCOP 1.63 freeze date was dated 2003-02-04, with a file datestamp of 2003-02-04.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: 0.275
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1mkha_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mkhA (A:)
    myvkfddfakldlrvgkiievkdhpnadklyvvkvdlgdevrtlvaglkkyykpeellnr
    yvvvvanlepkklrgigsqgmllaaddgervallmpdkevklgakvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mkhA (A:)
    myvkfddfakldlrvgkiievkdhpnadklyvvkvdlgdevrtlvaglkkyykpeellnr
    yvvvvanlepkklgigsqgmllaaddgervallmpdkevklgakvr