PDB entry 1mkg

View 1mkg on RCSB PDB site
Description: DISULFIDE DEFICIENT MUTANT OF VASCULAR ENDOTHELIAL GROWTH FACTOR A (C57A and C102A)
Class: hormone/growth factor
Keywords: cystine-knot growth factor, HORMONE-GROWTH FACTOR COMPLEX
Deposited on 2002-08-29, released 2002-12-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: -1.8 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vascular Endothelial Growth Factor A
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15692 (1-End)
      • engineered (44)
      • engineered (89)
    Domains in SCOPe 2.07: d1mkga_
  • Chain 'B':
    Compound: Vascular Endothelial Growth Factor A
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15692 (1-End)
      • engineered (44)
      • engineered (89)
    Domains in SCOPe 2.07: d1mkgb_
  • Chain 'C':
    Compound: Vascular Endothelial Growth Factor A
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15692 (1-End)
      • engineered (44)
      • engineered (89)
    Domains in SCOPe 2.07: d1mkgc_
  • Chain 'D':
    Compound: Vascular Endothelial Growth Factor A
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15692 (1-End)
      • engineered (44)
      • engineered (89)
    Domains in SCOPe 2.07: d1mkgd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mkgA (A:)
    mvvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmraggccndeglecvpte
    esnitmqimrikphqgqhigemsflqhnkaecrpkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mkgA (A:)
    vvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmraggccndeglecvptee
    snitmqimrikphqgqhigemsflqhnkaecrpk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mkgB (B:)
    mvvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmraggccndeglecvpte
    esnitmqimrikphqgqhigemsflqhnkaecrpkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mkgB (B:)
    vvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmraggccndeglecvptee
    snitmqimrikphqgqhigemsflqhnkaecrpk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1mkgC (C:)
    mvvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmraggccndeglecvpte
    esnitmqimrikphqgqhigemsflqhnkaecrpkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mkgC (C:)
    vvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmraggccndeglecvptee
    snitmqimrikphqgqhigemsflqhnkaecrpk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1mkgD (D:)
    mvvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmraggccndeglecvpte
    esnitmqimrikphqgqhigemsflqhnkaecrpkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mkgD (D:)
    vvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmraggccndeglecvptee
    snitmqimrikphqgqhigemsflqhnkaecrpk