PDB entry 1mkc

View 1mkc on RCSB PDB site
Description: c-terminal domain of midkine
Deposited on 1999-03-16, released 1999-03-23
The last revision prior to the SCOP 1.55 freeze date was dated 1999-04-21, with a file datestamp of 1999-04-20.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1mkca_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mkcA (A:)
    ckykfenwgacdggtgtkvrqgtlkkarynaqcqetirvtkpc