PDB entry 1mjn

View 1mjn on RCSB PDB site
Description: Crystal Structure of the intermediate affinity aL I domain mutant
Class: immune system
Keywords: Rossmann Fold, IMMUNE SYSTEM
Deposited on 2002-08-28, released 2003-01-28
The last revision prior to the SCOPe 2.03 freeze date was dated 2010-05-19, with a file datestamp of 2010-05-14.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.156
AEROSPACI score: 0.76 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Integrin alpha-L
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20701 (0-178)
      • engineered (33)
      • engineered (171)
    Domains in SCOPe 2.03: d1mjna_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mjnA (A:)
    gnvdlvflfdgsmslqpdefqkildfmkdvmkkcsntsyqfaavqfstsyktefdfsdyv
    krkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeatdsgn
    idaakdiiryiigigkhfqtkesqetlhkfaskpasefvkildtfeklkdlctelqkki