PDB entry 1mji

View 1mji on RCSB PDB site
Description: detailed analysis of RNA-protein interactions within the bacterial ribosomal protein l5/5s rRNA complex
Class: ribosome
Keywords: ribosomal protein - 5S rRNA complex, RIBOSOME
Deposited on 2002-08-28, released 2003-01-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.21
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 50S ribosomal protein L5
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41201 (Start-181)
      • modified residue (98)
      • modified residue (154)
    Domains in SCOPe 2.08: d1mjia_
  • Chain 'B':
    Compound: 50S ribosomal protein L5
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41201 (Start-181)
      • modified residue (98)
      • modified residue (154)
    Domains in SCOPe 2.08: d1mjib_
  • Chain 'C':
    Compound: 5S rRNA fragment
    Species: Escherichia coli [TaxId:562]
  • Chain 'D':
    Compound: 5S rRNA fragment
    Species: Escherichia coli [TaxId:562]
  • Heterogens: MG, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mjiA (A:)
    mpldvalkrkyyeevrpelirrfgyqnvwevprlekvvinqglgeakedarilekaaqel
    alitgqkpavtrakksisnfklrkgmpiglrvtlrrdrmwiflekllnvalprirdfrgl
    npnsfdgrgnynlglreqlifpeitydmvdalrgmdiavvttaetdeearallellgfpf
    rk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mjiA (A:)
    ldvalkrkyyeevrpelirrfgyqnvwevprlekvvinqglgeakedarilekaaqelal
    itgqkpavtrakksisnfklrkgmpiglrvtlrrdrmwiflekllnvalprirdfrglnp
    nsfdgrgnynlglreqlifpeitydmvdalrgmdiavvttaetdeearallellgfpfrk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mjiB (B:)
    mpldvalkrkyyeevrpelirrfgyqnvwevprlekvvinqglgeakedarilekaaqel
    alitgqkpavtrakksisnfklrkgmpiglrvtlrrdrmwiflekllnvalprirdfrgl
    npnsfdgrgnynlglreqlifpeitydmvdalrgmdiavvttaetdeearallellgfpf
    rk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mjiB (B:)
    dvalkrkyyeevrpelirrfgyqnvwevprlekvvinqglgeakedarilekaaqelali
    tgqkpavtrakksisnfklrkgmpiglrvtlrrdrmwiflekllnvalprirdfrglnpn
    sfdgrgnynlglreqlifpeitydmvdalrgmdiavvttaetdeearallellgfpfrk
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.