PDB entry 1mjg

View 1mjg on RCSB PDB site
Description: crystal structure of bifunctional carbon monoxide dehydrogenase/acetyl-coa synthase(codh/acs) from moorella thermoacetica (f. clostridium thermoaceticum)
Deposited on 2002-08-27, released 2003-01-28
The last revision prior to the SCOP 1.65 freeze date was dated 2003-01-28, with a file datestamp of 2003-01-28.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.215
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1mjga_
  • Chain 'B':
    Domains in SCOP 1.65: d1mjgb_
  • Chain 'C':
    Domains in SCOP 1.65: d1mjgc_
  • Chain 'D':
    Domains in SCOP 1.65: d1mjgd_
  • Chain 'M':
    Domains in SCOP 1.65: d1mjgm_
  • Chain 'N':
    Domains in SCOP 1.65: d1mjgn_
  • Chain 'O':
    Domains in SCOP 1.65: d1mjgo_
  • Chain 'P':
    Domains in SCOP 1.65: d1mjgp_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mjgA (A:)
    mprfrdlshncrpseaprvmepknrdrtvdpavlemlvkskddkvitafdrfvaqqpqck
    igyegiccrfcmagpcrikatdgpgsrgicgasawtivarnvglmiltgaaahcehgnhi
    ahalvemaegkapdysvkdeaklkevcrrvgievegksvlelaqevgekaledfrrlkge
    geatwlmttinegrkekfrthnvvpfgihasiselvnqahmgmdndpvnlvfsairvala
    dytgehiatdfsdilfgtpqpvvseanmgvldpdqvnfvlhghnpllseiivqaaremeg
    eakaagakginlvgicctgnevlmrqgiplvtsfasqelaictgaidamcvdvqcimpsi
    savaecyhtriittadnakipgayhidyqtataiesaktairmaieafkerkesnrpvyi
    pqiknrvvagwslealtkllatqnaqnpirvlnqaildgelagvalicgcnnlkgfqdns
    hltvmkellknnvfvvatgcsaqaagklglldpanvetycgdglkgflkrlgeganieig
    lppvfhmgscvdnsravdllmamandlgvdtpkvpfvasapeamsgkaaaigtwwvslgv
    pthvgtmppvegsdliysiltqiasdvyggyfifemdpqvaarkildaleyrtwklgvhk
    evaeryetklcqgy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mjgA (A:)
    rfrdlshncrpseaprvmepknrdrtvdpavlemlvkskddkvitafdrfvaqqpqckig
    yegiccrfcmagpcrikatdgpgsrgicgasawtivarnvglmiltgaaahcehgnhiah
    alvemaegkapdysvkdeaklkevcrrvgievegksvlelaqevgekaledfrrlkgege
    atwlmttinegrkekfrthnvvpfgihasiselvnqahmgmdndpvnlvfsairvalady
    tgehiatdfsdilfgtpqpvvseanmgvldpdqvnfvlhghnpllseiivqaaremegea
    kaagakginlvgicctgnevlmrqgiplvtsfasqelaictgaidamcvdvqcimpsisa
    vaecyhtriittadnakipgayhidyqtataiesaktairmaieafkerkesnrpvyipq
    iknrvvagwslealtkllatqnaqnpirvlnqaildgelagvalicgcnnlkgfqdnshl
    tvmkellknnvfvvatgcsaqaagklglldpanvetycgdglkgflkrlgeganieiglp
    pvfhmgscvdnsravdllmamandlgvdtpkvpfvasapeamsgkaaaigtwwvslgvpt
    hvgtmppvegsdliysiltqiasdvyggyfifemdpqvaarkildaleyrtwklgvhkev
    aeryetklcqgy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mjgB (B:)
    mprfrdlshncrpseaprvmepknrdrtvdpavlemlvkskddkvitafdrfvaqqpqck
    igyegiccrfcmagpcrikatdgpgsrgicgasawtivarnvglmiltgaaahcehgnhi
    ahalvemaegkapdysvkdeaklkevcrrvgievegksvlelaqevgekaledfrrlkge
    geatwlmttinegrkekfrthnvvpfgihasiselvnqahmgmdndpvnlvfsairvala
    dytgehiatdfsdilfgtpqpvvseanmgvldpdqvnfvlhghnpllseiivqaaremeg
    eakaagakginlvgicctgnevlmrqgiplvtsfasqelaictgaidamcvdvqcimpsi
    savaecyhtriittadnakipgayhidyqtataiesaktairmaieafkerkesnrpvyi
    pqiknrvvagwslealtkllatqnaqnpirvlnqaildgelagvalicgcnnlkgfqdns
    hltvmkellknnvfvvatgcsaqaagklglldpanvetycgdglkgflkrlgeganieig
    lppvfhmgscvdnsravdllmamandlgvdtpkvpfvasapeamsgkaaaigtwwvslgv
    pthvgtmppvegsdliysiltqiasdvyggyfifemdpqvaarkildaleyrtwklgvhk
    evaeryetklcqgy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mjgB (B:)
    rfrdlshncrpseaprvmepknrdrtvdpavlemlvkskddkvitafdrfvaqqpqckig
    yegiccrfcmagpcrikatdgpgsrgicgasawtivarnvglmiltgaaahcehgnhiah
    alvemaegkapdysvkdeaklkevcrrvgievegksvlelaqevgekaledfrrlkgege
    atwlmttinegrkekfrthnvvpfgihasiselvnqahmgmdndpvnlvfsairvalady
    tgehiatdfsdilfgtpqpvvseanmgvldpdqvnfvlhghnpllseiivqaaremegea
    kaagakginlvgicctgnevlmrqgiplvtsfasqelaictgaidamcvdvqcimpsisa
    vaecyhtriittadnakipgayhidyqtataiesaktairmaieafkerkesnrpvyipq
    iknrvvagwslealtkllatqnaqnpirvlnqaildgelagvalicgcnnlkgfqdnshl
    tvmkellknnvfvvatgcsaqaagklglldpanvetycgdglkgflkrlgeganieiglp
    pvfhmgscvdnsravdllmamandlgvdtpkvpfvasapeamsgkaaaigtwwvslgvpt
    hvgtmppvegsdliysiltqiasdvyggyfifemdpqvaarkildaleyrtwklgvhkev
    aeryetklcqgy
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1mjgC (C:)
    mprfrdlshncrpseaprvmepknrdrtvdpavlemlvkskddkvitafdrfvaqqpqck
    igyegiccrfcmagpcrikatdgpgsrgicgasawtivarnvglmiltgaaahcehgnhi
    ahalvemaegkapdysvkdeaklkevcrrvgievegksvlelaqevgekaledfrrlkge
    geatwlmttinegrkekfrthnvvpfgihasiselvnqahmgmdndpvnlvfsairvala
    dytgehiatdfsdilfgtpqpvvseanmgvldpdqvnfvlhghnpllseiivqaaremeg
    eakaagakginlvgicctgnevlmrqgiplvtsfasqelaictgaidamcvdvqcimpsi
    savaecyhtriittadnakipgayhidyqtataiesaktairmaieafkerkesnrpvyi
    pqiknrvvagwslealtkllatqnaqnpirvlnqaildgelagvalicgcnnlkgfqdns
    hltvmkellknnvfvvatgcsaqaagklglldpanvetycgdglkgflkrlgeganieig
    lppvfhmgscvdnsravdllmamandlgvdtpkvpfvasapeamsgkaaaigtwwvslgv
    pthvgtmppvegsdliysiltqiasdvyggyfifemdpqvaarkildaleyrtwklgvhk
    evaeryetklcqgy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mjgC (C:)
    rfrdlshncrpseaprvmepknrdrtvdpavlemlvkskddkvitafdrfvaqqpqckig
    yegiccrfcmagpcrikatdgpgsrgicgasawtivarnvglmiltgaaahcehgnhiah
    alvemaegkapdysvkdeaklkevcrrvgievegksvlelaqevgekaledfrrlkgege
    atwlmttinegrkekfrthnvvpfgihasiselvnqahmgmdndpvnlvfsairvalady
    tgehiatdfsdilfgtpqpvvseanmgvldpdqvnfvlhghnpllseiivqaaremegea
    kaagakginlvgicctgnevlmrqgiplvtsfasqelaictgaidamcvdvqcimpsisa
    vaecyhtriittadnakipgayhidyqtataiesaktairmaieafkerkesnrpvyipq
    iknrvvagwslealtkllatqnaqnpirvlnqaildgelagvalicgcnnlkgfqdnshl
    tvmkellknnvfvvatgcsaqaagklglldpanvetycgdglkgflkrlgeganieiglp
    pvfhmgscvdnsravdllmamandlgvdtpkvpfvasapeamsgkaaaigtwwvslgvpt
    hvgtmppvegsdliysiltqiasdvyggyfifemdpqvaarkildaleyrtwklgvhkev
    aeryetklcqgy
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1mjgD (D:)
    mprfrdlshncrpseaprvmepknrdrtvdpavlemlvkskddkvitafdrfvaqqpqck
    igyegiccrfcmagpcrikatdgpgsrgicgasawtivarnvglmiltgaaahcehgnhi
    ahalvemaegkapdysvkdeaklkevcrrvgievegksvlelaqevgekaledfrrlkge
    geatwlmttinegrkekfrthnvvpfgihasiselvnqahmgmdndpvnlvfsairvala
    dytgehiatdfsdilfgtpqpvvseanmgvldpdqvnfvlhghnpllseiivqaaremeg
    eakaagakginlvgicctgnevlmrqgiplvtsfasqelaictgaidamcvdvqcimpsi
    savaecyhtriittadnakipgayhidyqtataiesaktairmaieafkerkesnrpvyi
    pqiknrvvagwslealtkllatqnaqnpirvlnqaildgelagvalicgcnnlkgfqdns
    hltvmkellknnvfvvatgcsaqaagklglldpanvetycgdglkgflkrlgeganieig
    lppvfhmgscvdnsravdllmamandlgvdtpkvpfvasapeamsgkaaaigtwwvslgv
    pthvgtmppvegsdliysiltqiasdvyggyfifemdpqvaarkildaleyrtwklgvhk
    evaeryetklcqgy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mjgD (D:)
    rfrdlshncrpseaprvmepknrdrtvdpavlemlvkskddkvitafdrfvaqqpqckig
    yegiccrfcmagpcrikatdgpgsrgicgasawtivarnvglmiltgaaahcehgnhiah
    alvemaegkapdysvkdeaklkevcrrvgievegksvlelaqevgekaledfrrlkgege
    atwlmttinegrkekfrthnvvpfgihasiselvnqahmgmdndpvnlvfsairvalady
    tgehiatdfsdilfgtpqpvvseanmgvldpdqvnfvlhghnpllseiivqaaremegea
    kaagakginlvgicctgnevlmrqgiplvtsfasqelaictgaidamcvdvqcimpsisa
    vaecyhtriittadnakipgayhidyqtataiesaktairmaieafkerkesnrpvyipq
    iknrvvagwslealtkllatqnaqnpirvlnqaildgelagvalicgcnnlkgfqdnshl
    tvmkellknnvfvvatgcsaqaagklglldpanvetycgdglkgflkrlgeganieiglp
    pvfhmgscvdnsravdllmamandlgvdtpkvpfvasapeamsgkaaaigtwwvslgvpt
    hvgtmppvegsdliysiltqiasdvyggyfifemdpqvaarkildaleyrtwklgvhkev
    aeryetklcqgy
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1mjgM (M:)
    mtdfdkifegaipegkepvalfrevyhgaitatsyaeillnqairtygpdhpvgypdtay
    ylpvircfsgeevkklgdlppilnrkraqvspvlnfenarlageatwyaaeiiealrylk
    ykpdepllpppwtgfigdpvvrrfgikmvdwtipgeaiilgrakdskalakivkelmgmg
    fmlficdeaveqlleenvklgidyiayplgnftqivhaanyalragmmfggvtpgareeq
    rdyqrrrirafvlylgehdmvktaaafgaiftgfpvitdqplpedkqipdwffsvedydk
    ivqiametrgikltkikldlpinfgpafegesirkgdmyvemggnrtpafelvrtvsese
    itdgkievigpdidqipegsklplgilvdiygrkmqadfegvlerrihdfinygeglwht
    gqrninwlrvskdavakgfrfknygeilvakmkeefpaivdrvqvtiftdeakvkeymev
    arekykerddrmrgltdetvdtfyscvlcqsfapnhvcivtpervglcgavswldakasy
    einhagpnqpipkegeidpikgiwksvndylytasnrnleqvclytlmenpmtscgcfea
    imailpecngimittrdhagmtpsgmtfstlagmigggtqtpgfmgigrtyivskkfisa
    dggiarivwmpkslkdflhdefvrssveeglgedfidkiadetigttvdeilpyleekgh
    paltmdpim
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mjgM (M:)
    tdfdkifegaipegkepvalfrevyhgaitatsyaeillnqairtygpdhpvgypdtayy
    lpvircfsgeevkklgdlppilnrkraqvspvlnfenarlageatwyaaeiiealrylky
    kpdepllpppwtgfigdpvvrrfgikmvdwtipgeaiilgrakdskalakivkelmgmgf
    mlficdeaveqlleenvklgidyiayplgnftqivhaanyalragmmfggvtpgareeqr
    dyqrrrirafvlylgehdmvktaaafgaiftgfpvitdqplpedkqipdwffsvedydki
    vqiametrgikltkikldlpinfgpafegesirkgdmyvemggnrtpafelvrtvsesei
    tdgkievigpdidqipegsklplgilvdiygrkmqadfegvlerrihdfinygeglwhtg
    qrninwlrvskdavakgfrfknygeilvakmkeefpaivdrvqvtiftdeakvkeymeva
    rekykerddrmrgltdetvdtfyscvlcqsfapnhvcivtpervglcgavswldakasye
    inhagpnqpipkegeidpikgiwksvndylytasnrnleqvclytlmenpmtscgcfeai
    mailpecngimittrdhagmtpsgmtfstlagmigggtqtpgfmgigrtyivskkfisad
    ggiarivwmpkslkdflhdefvrssveeglgedfidkiadetigttvdeilpyleekghp
    altmdpim
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1mjgN (N:)
    mtdfdkifegaipegkepvalfrevyhgaitatsyaeillnqairtygpdhpvgypdtay
    ylpvircfsgeevkklgdlppilnrkraqvspvlnfenarlageatwyaaeiiealrylk
    ykpdepllpppwtgfigdpvvrrfgikmvdwtipgeaiilgrakdskalakivkelmgmg
    fmlficdeaveqlleenvklgidyiayplgnftqivhaanyalragmmfggvtpgareeq
    rdyqrrrirafvlylgehdmvktaaafgaiftgfpvitdqplpedkqipdwffsvedydk
    ivqiametrgikltkikldlpinfgpafegesirkgdmyvemggnrtpafelvrtvsese
    itdgkievigpdidqipegsklplgilvdiygrkmqadfegvlerrihdfinygeglwht
    gqrninwlrvskdavakgfrfknygeilvakmkeefpaivdrvqvtiftdeakvkeymev
    arekykerddrmrgltdetvdtfyscvlcqsfapnhvcivtpervglcgavswldakasy
    einhagpnqpipkegeidpikgiwksvndylytasnrnleqvclytlmenpmtscgcfea
    imailpecngimittrdhagmtpsgmtfstlagmigggtqtpgfmgigrtyivskkfisa
    dggiarivwmpkslkdflhdefvrssveeglgedfidkiadetigttvdeilpyleekgh
    paltmdpim
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mjgN (N:)
    tdfdkifegaipegkepvalfrevyhgaitatsyaeillnqairtygpdhpvgypdtayy
    lpvircfsgeevkklgdlppilnrkraqvspvlnfenarlageatwyaaeiiealrylky
    kpdepllpppwtgfigdpvvrrfgikmvdwtipgeaiilgrakdskalakivkelmgmgf
    mlficdeaveqlleenvklgidyiayplgnftqivhaanyalragmmfggvtpgareeqr
    dyqrrrirafvlylgehdmvktaaafgaiftgfpvitdqplpedkqipdwffsvedydki
    vqiametrgikltkikldlpinfgpafegesirkgdmyvemggnrtpafelvrtvsesei
    tdgkievigpdidqipegsklplgilvdiygrkmqadfegvlerrihdfinygeglwhtg
    qrninwlrvskdavakgfrfknygeilvakmkeefpaivdrvqvtiftdeakvkeymeva
    rekykerddrmrgltdetvdtfyscvlcqsfapnhvcivtpervglcgavswldakasye
    inhagpnqpipkegeidpikgiwksvndylytasnrnleqvclytlmenpmtscgcfeai
    mailpecngimittrdhagmtpsgmtfstlagmigggtqtpgfmgigrtyivskkfisad
    ggiarivwmpkslkdflhdefvrssveeglgedfidkiadetigttvdeilpyleekghp
    altmdpim
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >1mjgO (O:)
    mtdfdkifegaipegkepvalfrevyhgaitatsyaeillnqairtygpdhpvgypdtay
    ylpvircfsgeevkklgdlppilnrkraqvspvlnfenarlageatwyaaeiiealrylk
    ykpdepllpppwtgfigdpvvrrfgikmvdwtipgeaiilgrakdskalakivkelmgmg
    fmlficdeaveqlleenvklgidyiayplgnftqivhaanyalragmmfggvtpgareeq
    rdyqrrrirafvlylgehdmvktaaafgaiftgfpvitdqplpedkqipdwffsvedydk
    ivqiametrgikltkikldlpinfgpafegesirkgdmyvemggnrtpafelvrtvsese
    itdgkievigpdidqipegsklplgilvdiygrkmqadfegvlerrihdfinygeglwht
    gqrninwlrvskdavakgfrfknygeilvakmkeefpaivdrvqvtiftdeakvkeymev
    arekykerddrmrgltdetvdtfyscvlcqsfapnhvcivtpervglcgavswldakasy
    einhagpnqpipkegeidpikgiwksvndylytasnrnleqvclytlmenpmtscgcfea
    imailpecngimittrdhagmtpsgmtfstlagmigggtqtpgfmgigrtyivskkfisa
    dggiarivwmpkslkdflhdefvrssveeglgedfidkiadetigttvdeilpyleekgh
    paltmdpim
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mjgO (O:)
    tdfdkifegaipegkepvalfrevyhgaitatsyaeillnqairtygpdhpvgypdtayy
    lpvircfsgeevkklgdlppilnrkraqvspvlnfenarlageatwyaaeiiealrylky
    kpdepllpppwtgfigdpvvrrfgikmvdwtipgeaiilgrakdskalakivkelmgmgf
    mlficdeaveqlleenvklgidyiayplgnftqivhaanyalragmmfggvtpgareeqr
    dyqrrrirafvlylgehdmvktaaafgaiftgfpvitdqplpedkqipdwffsvedydki
    vqiametrgikltkikldlpinfgpafegesirkgdmyvemggnrtpafelvrtvsesei
    tdgkievigpdidqipegsklplgilvdiygrkmqadfegvlerrihdfinygeglwhtg
    qrninwlrvskdavakgfrfknygeilvakmkeefpaivdrvqvtiftdeakvkeymeva
    rekykerddrmrgltdetvdtfyscvlcqsfapnhvcivtpervglcgavswldakasye
    inhagpnqpipkegeidpikgiwksvndylytasnrnleqvclytlmenpmtscgcfeai
    mailpecngimittrdhagmtpsgmtfstlagmigggtqtpgfmgigrtyivskkfisad
    ggiarivwmpkslkdflhdefvrssveeglgedfidkiadetigttvdeilpyleekghp
    altmdpim
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >1mjgP (P:)
    mtdfdkifegaipegkepvalfrevyhgaitatsyaeillnqairtygpdhpvgypdtay
    ylpvircfsgeevkklgdlppilnrkraqvspvlnfenarlageatwyaaeiiealrylk
    ykpdepllpppwtgfigdpvvrrfgikmvdwtipgeaiilgrakdskalakivkelmgmg
    fmlficdeaveqlleenvklgidyiayplgnftqivhaanyalragmmfggvtpgareeq
    rdyqrrrirafvlylgehdmvktaaafgaiftgfpvitdqplpedkqipdwffsvedydk
    ivqiametrgikltkikldlpinfgpafegesirkgdmyvemggnrtpafelvrtvsese
    itdgkievigpdidqipegsklplgilvdiygrkmqadfegvlerrihdfinygeglwht
    gqrninwlrvskdavakgfrfknygeilvakmkeefpaivdrvqvtiftdeakvkeymev
    arekykerddrmrgltdetvdtfyscvlcqsfapnhvcivtpervglcgavswldakasy
    einhagpnqpipkegeidpikgiwksvndylytasnrnleqvclytlmenpmtscgcfea
    imailpecngimittrdhagmtpsgmtfstlagmigggtqtpgfmgigrtyivskkfisa
    dggiarivwmpkslkdflhdefvrssveeglgedfidkiadetigttvdeilpyleekgh
    paltmdpim
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mjgP (P:)
    tdfdkifegaipegkepvalfrevyhgaitatsyaeillnqairtygpdhpvgypdtayy
    lpvircfsgeevkklgdlppilnrkraqvspvlnfenarlageatwyaaeiiealrylky
    kpdepllpppwtgfigdpvvrrfgikmvdwtipgeaiilgrakdskalakivkelmgmgf
    mlficdeaveqlleenvklgidyiayplgnftqivhaanyalragmmfggvtpgareeqr
    dyqrrrirafvlylgehdmvktaaafgaiftgfpvitdqplpedkqipdwffsvedydki
    vqiametrgikltkikldlpinfgpafegesirkgdmyvemggnrtpafelvrtvsesei
    tdgkievigpdidqipegsklplgilvdiygrkmqadfegvlerrihdfinygeglwhtg
    qrninwlrvskdavakgfrfknygeilvakmkeefpaivdrvqvtiftdeakvkeymeva
    rekykerddrmrgltdetvdtfyscvlcqsfapnhvcivtpervglcgavswldakasye
    inhagpnqpipkegeidpikgiwksvndylytasnrnleqvclytlmenpmtscgcfeai
    mailpecngimittrdhagmtpsgmtfstlagmigggtqtpgfmgigrtyivskkfisad
    ggiarivwmpkslkdflhdefvrssveeglgedfidkiadetigttvdeilpyleekghp
    altmdpim