PDB entry 1mj8

View 1mj8 on RCSB PDB site
Description: High Resolution Crystal Structure Of The Fab Fragment of The Esterolytic Antibody MS6-126
Class: immune system
Keywords: catalytic antibody, ester hydrolysis, esterolytic, fab, immunoglobulin, immune system
Deposited on 2002-08-27, released 2003-09-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.155
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: immunoglobulin ms6-126
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1MJ8
    Domains in SCOPe 2.07: d1mj8h1, d1mj8h2, d1mj8h3
  • Chain 'L':
    Compound: immunoglobulin ms6-126
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1MJ8 (0-218)
    Domains in SCOPe 2.07: d1mj8l1, d1mj8l2
  • Heterogens: PO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1mj8H (H:)
    qvqlqqpgaelvkpgasvklsckasgytftsnwinwvkqrpgqglewigniypgsgytny
    nerfkskatltvdtssstaymqlssltsddsavyycarkhyfydgvvywgqgtlvtvsaa
    kttapsvyplapvcgdtsgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdl
    ytlsssvtvtsstwpsqsitcnvahpasstkvdkkieprgptikpcppck
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mj8H (H:)
    vqlqqpgaelvkpgasvklsckasgytftsnwinwvkqrpgqglewigniypgsgytnyn
    erfkskatltvdtssstaymqlssltsddsavyycarkhyfydgvvywgqgtlvtvsaak
    ttapsvyplapvcssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytlsss
    vtvtsstwpsqsitcnvahpasstkvdkkieprgpt
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1mj8L (L:)
    eivmtqaapsvpvtpgesvsiscrssksllhsngntylywflqrpgqspqlliyrmsnla
    sgvpdrfsgsgsgtaftlrisrveaedvgvyyclqhleypftfgagtklelkradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mj8L (L:)
    eivmtqaapsvpvtpgesvsiscrssksllhsngntylywflqrpgqspqlliyrmsnla
    sgvpdrfsgsgsgtaftlrisrveaedvgvyyclqhleypftfgagtklelkradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathpivksfnrnec