PDB entry 1mil

View 1mil on RCSB PDB site
Description: transforming protein
Class: transforming protein
Keywords: sh2 domain, phosphorylation, collagen, growth regulation, transforming protein, alternative initiation
Deposited on 1995-09-20, released 1996-11-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.173
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: shc adaptor protein
    Species: Homo sapiens [TaxId:9606]
    Gene: T7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1mila_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1milA (A:)
    gsqlrgepwfhgklsrreaeallqlngdflvrestttpgqyvltglqsgqpkhlllvdpe
    gvvrtkdhrfesvshlisyhmdnhlpiisagselclqqpverkl