PDB entry 1mik

View 1mik on RCSB PDB site
Description: the role of water molecules in the structure-based design of (5-hydroxynorvaline)-2-cyclosporin: synthesis, biological activity, and crystallographic analysis with cyclophilin a
Deposited on 1995-09-20, released 1996-03-08
The last revision prior to the SCOP 1.65 freeze date was dated 1996-03-08, with a file datestamp of 1996-03-11.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: 0.175
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.65: d1mika_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1mikA (A:)
  mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
  mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
  wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle