PDB entry 1mi1

View 1mi1 on RCSB PDB site
Description: Crystal Structure of the PH-BEACH Domain of Human Neurobeachin
Class: signaling protein
Keywords: PH domain, BEACH domain, vesicle trafficking, signal transduction, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, SIGNALING PROTEIN
Deposited on 2002-08-21, released 2002-09-27
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.23
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neurobeachin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8NFP9 (0-413)
      • cloning artifact (58)
      • cloning artifact (81)
      • cloning artifact (88)
      • cloning artifact (135)
      • cloning artifact (151)
      • cloning artifact (294)
      • cloning artifact (333)
      • cloning artifact (391)
    Domains in SCOPe 2.04: d1mi1a1, d1mi1a2
  • Chain 'B':
    Compound: Neurobeachin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8NFP9 (0-413)
      • cloning artifact (58)
      • cloning artifact (81)
      • cloning artifact (88)
      • cloning artifact (135)
      • cloning artifact (151)
      • cloning artifact (294)
      • cloning artifact (333)
      • cloning artifact (391)
    Domains in SCOPe 2.04: d1mi1b1, d1mi1b2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mi1A (A:)
    gpvvlstpaqliapvvvakgtlsittteiyfevdeddsafkkidtkvlayteglhgkwmf
    seiravfsrryllqntalevfmanrtsvmfnfpdqatvkkvvyslprvgvgtsyglpqar
    rislatprqlykssnmtqrwqrreisnfeylmflntiagrtyndlnqypvfpwvltnyes
    eeldltlpgnfrdlskpigalnpkravfyaeryetweddqsppyhynthystatstlswl
    vriepfttfflnandgkfdhpdrtfssvarswrtsqrdtsdvkelipefyylpemfvnsn
    gynlgvredevvvndvdlppwakkpedfvrinrmalesefvscqlhqwidlifgykqrgp
    eavralnvfhyltyegsvnldsitdpvlreameaqiqnfgqtpsqlliephppr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mi1B (B:)
    gpvvlstpaqliapvvvakgtlsittteiyfevdeddsafkkidtkvlayteglhgkwmf
    seiravfsrryllqntalevfmanrtsvmfnfpdqatvkkvvyslprvgvgtsyglpqar
    rislatprqlykssnmtqrwqrreisnfeylmflntiagrtyndlnqypvfpwvltnyes
    eeldltlpgnfrdlskpigalnpkravfyaeryetweddqsppyhynthystatstlswl
    vriepfttfflnandgkfdhpdrtfssvarswrtsqrdtsdvkelipefyylpemfvnsn
    gynlgvredevvvndvdlppwakkpedfvrinrmalesefvscqlhqwidlifgykqrgp
    eavralnvfhyltyegsvnldsitdpvlreameaqiqnfgqtpsqlliephppr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mi1B (B:)
    gpvvlstpaqliapvvvakgtlsittteiyfevdeddsafkkidtkvlayteglhgkwmf
    seiravfsrryllqntalevfmanrtsvmfnfpdqatvkkvvyslprvgvgtsyglpqar
    rislatprqlykssnmtqrwqrreisnfeylmflntiagrtyndlnqypvfpwvltnyes
    eeldltlpgnfrdlskpigalnpkravfyaeryetweddqsppyhynthystatstlswl
    vriepfttfflnandgkfdhpdrtfssvarswrtsqrdtsdvkelipefyylpemfvnsn
    dvdlppwakkpedfvrinrmalesefvscqlhqwidlifgykqrgpeavralnvfhylty
    egsvnldsitdpvlreameaqiqnfgqtpsqlliephppr