PDB entry 1mi1

View 1mi1 on RCSB PDB site
Description: Crystal Structure of the PH-BEACH Domain of Human Neurobeachin
Deposited on 2002-08-21, released 2002-09-27
The last revision prior to the SCOP 1.63 freeze date was dated 2002-09-27, with a file datestamp of 2002-09-27.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.23
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mi1A (A:)
    gpvvlstpaqliapvvvakgtlsittteiyfevdeddsafkkidtkvlayteglhgkwmf
    seiravfsrryllqntalevfmanrtsvmfnfpdqatvkkvvyslprvgvgtsyglpqar
    rislatprqlykssnmtqrwqrreisnfeylmflntiagrtyndlnqypvfpwvltnyes
    eeldltlpgnfrdlskpigalnpkravfyaeryetweddqsppyhynthystatstlswl
    vriepfttfflnandgkfdhpdrtfssvarswrtsqrdtsdvkelipefyylpemfvnsn
    gynlgvredevvvndvdlppwakkpedfvrinrmalesefvscqlhqwidlifgykqrgp
    eavralnvfhyltyegsvnldsitdpvlreameaqiqnfgqtpsqlliephppr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mi1B (B:)
    gpvvlstpaqliapvvvakgtlsittteiyfevdeddsafkkidtkvlayteglhgkwmf
    seiravfsrryllqntalevfmanrtsvmfnfpdqatvkkvvyslprvgvgtsyglpqar
    rislatprqlykssnmtqrwqrreisnfeylmflntiagrtyndlnqypvfpwvltnyes
    eeldltlpgnfrdlskpigalnpkravfyaeryetweddqsppyhynthystatstlswl
    vriepfttfflnandgkfdhpdrtfssvarswrtsqrdtsdvkelipefyylpemfvnsn
    gynlgvredevvvndvdlppwakkpedfvrinrmalesefvscqlhqwidlifgykqrgp
    eavralnvfhyltyegsvnldsitdpvlreameaqiqnfgqtpsqlliephppr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mi1B (B:)
    gpvvlstpaqliapvvvakgtlsittteiyfevdeddsafkkidtkvlayteglhgkwmf
    seiravfsrryllqntalevfmanrtsvmfnfpdqatvkkvvyslprvgvgtsyglpqar
    rislatprqlykssnmtqrwqrreisnfeylmflntiagrtyndlnqypvfpwvltnyes
    eeldltlpgnfrdlskpigalnpkravfyaeryetweddqsppyhynthystatstlswl
    vriepfttfflnandgkfdhpdrtfssvarswrtsqrdtsdvkelipefyylpemfvnsn
    dvdlppwakkpedfvrinrmalesefvscqlhqwidlifgykqrgpeavralnvfhylty
    egsvnldsitdpvlreameaqiqnfgqtpsqlliephppr