PDB entry 1mi0

View 1mi0 on RCSB PDB site
Description: Crystal Structure of the redesigned protein G variant NuG2
Class: immune system
Keywords: alpha-beta protein, redesigned beta-hairpin, IMMUNE SYSTEM
Deposited on 2002-08-21, released 2002-09-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.26
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: immunoglobulin-binding protein G
    Species: Finegoldia magna [TaxId:334413]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PIR A45063 (9-End)
      • expression tag (4-7)
      • see remark 999 (14-24)
      • engineered (54)
      • expression tag (7-8)
      • see remark 999 (15-20)
      • see remark 999 (22-25)
      • engineered (55)
    Domains in SCOPe 2.07: d1mi0a1, d1mi0a2
  • Chain 'B':
    Compound: immunoglobulin-binding protein G
    Species: Finegoldia magna [TaxId:334413]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PIR A45063 (8-64)
      • expression tag (3-6)
      • see remark 999 (13-23)
      • engineered (53)
      • expression tag (6-7)
      • see remark 999 (14-19)
      • see remark 999 (21-24)
      • engineered (54)
    Domains in SCOPe 2.07: d1mi0b1, d1mi0b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mi0A (A:)
    mhhhhhhamdtyklvivlngttftytteavdaataekvfkqyandngvdgewtyadatkt
    ftvte
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mi0A (A:)
    hhhamdtyklvivlngttftytteavdaataekvfkqyandngvdgewtyadatktftvt
    e
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mi0B (B:)
    mhhhhhhamdtyklvivlngttftytteavdaataekvfkqyandngvdgewtyadatkt
    ftvte
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mi0B (B:)
    hhhhamdtyklvivlngttftytteavdaataekvfkqyandngvdgewtyadatktftv
    te